KEGG   Thermoproteus tenax: TTX_0300Help
Entry
TTX_0300          CDS       T01641                                 

Gene name
asnB
Definition
Asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ttn  Thermoproteus tenax
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ttn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
286451..287338
Genome map
AA seq 295 aa AA seqDB search
MSLPQLLREAAAEAQCDSVLLSGGLDSSTVAWALREAGLRPVAFNAQYAPRPGTDVPYLL
EVARQLGLRTVIVWASEEEAVRAAEEVVGILRVFNPMEVVNCAAAYLAMRAAAEMGARRI
CTGDGGDELFAGYSFMHKLPPRELDEYIRRLTETWYFCAFDVGKALGLEIQAPYLHPRVV
EYALSVPAEEKVRGGYGKYLVRRQFEGLLPREVVWRRKDPLEVGSGFAALYDVLAKRGEG
YEADIPVAGAARYLYKAFREKGLSYERGTRSPCPVCGHEMRGGYCPMCGHYEQKA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgccccagctcctgagggaggccgcagcggaggcgcagtgcgactcagtcctt
ctgtctggggggttggactcgtccactgtggcctgggcgcttagggaggccgggctgagg
cccgttgccttcaacgcacagtacgccccgaggcccgggaccgatgtgccctatctactc
gaagtggcgagacagctcggcctgcgcacggtcatcgtgtgggcgagcgaggaggaggcc
gtgagggcggcggaggaggtggtggggattctgagggttttcaacccgatggaggtggtc
aactgcgccgccgcgtatctggccatgagggccgcggccgagatgggggcgaggaggata
tgcacgggggacggcggagacgagctcttcgcaggctacagcttcatgcacaaactgcct
ccgagggagctcgacgagtatataaggcggctcaccgagacttggtacttctgcgccttc
gacgtgggcaaggcgcttgggcttgagatacaagcgccctatctccacccgagggtcgtc
gagtacgcgctctcggtgcccgccgaagagaaagtcagagggggctacggcaagtacctg
gtcagacgccagttcgagggcttgttgcccagagaggtcgtgtggcgccgtaaggacccg
ctggaggtcgggagcggcttcgccgctttatacgacgtcttggccaagaggggcgagggc
tatgaggccgacataccagtcgcgggcgctgccaggtatttgtacaaggcctttagagag
aaggggctgtcctacgagagggggacgaggagtccgtgccccgtctgcggccatgaaatg
aggggcggatactgccctatgtgcggccactacgagcagaaagcctag

DBGET integrated database retrieval system