KEGG   Thermoproteus tenax: TTX_0361Help
Entry
TTX_0361          CDS       T01641                                 

Gene name
thrC-2
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ttn  Thermoproteus tenax
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTX_0361 (thrC-2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTX_0361 (thrC-2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TTX_0361 (thrC-2)
Enzymes [BR:ttn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TTX_0361 (thrC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(336365..337366)
Genome map
AA seq 333 aa AA seqDB search
MEVVVKCARCGTERRGDELRCPRCGGPFIIEPQFPYRERARENFPYIRRWISLGEGNTPL
VELEGVKFKLEFLNPTGSFKDRGSATLISWLAERGVKRIAEDSSGNAGASIAAYGALAGM
EVEVYVPARARGGKLRQIEAYGAKVIKVRGSREEVSRAAERSGAYYASHIWRPEFRDGIR
TLAYELGKEAQGQEIYLPTSAGTLLLGVYYGFKHLLDSGVIQEMPRLIAVQTEQVRPLCA
AVKGEPYAPPKRVTSVADAIVSTNPPLLPEMAEIIRRHGDCVWVKDAEIGEAWKWLAKRG
LLVEPSSAAALAGMWKRGGKGIVVLTGSGLKTL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcgtagttaaatgcgccagatgcgggacggagaggaggggggacgagctgagg
tgccctaggtgcggcggccccttcataatagagccccagttcccctaccgcgagagagca
agggagaacttcccctatataaggaggtggataagcttgggcgagggcaacacccccctc
gtggagctggagggcgtgaagttcaagctggagttcctgaaccccaccggcagcttcaag
gacagaggctctgcaacgttgatctcctggctggcggaaaggggagtaaagaggatagca
gaggactcctctggcaacgccggggcctccatagcggcctacggcgcccttgccggaatg
gaggtcgaggtctacgtacccgcgagagcaaggggcggcaaactgaggcagatagaggcc
tacggcgcgaaggtgatcaaggtcagaggctctagggaggaggtctcgagggccgccgag
aggtcgggcgcctactacgcctcacacatctggaggcccgagttcagagacgggataagg
actctggcctacgagctcggtaaagaggcccagggacaggagatctatctccccacctcg
gcgggcaccctcctcctgggcgtctactacggcttcaaacaccttttagactccggcgtc
atccaggagatgcccaggcttatagctgtacagacagagcaggtgagacccctctgcgcc
gcagtaaagggcgagccctacgcgccgcccaagcgcgtcacctcagtggccgacgcaata
gtctccaccaatccgccccttctgcccgagatggctgagattataaggcgccacggagac
tgcgtgtgggtaaaggacgccgagataggggaggcttggaagtggttggccaagaggggg
cttctggtcgagccctcctcggccgcggccctggccggcatgtggaaaaggggcggaaag
gggattgtggttctgacggggagcgggctcaagacgctatga

DBGET integrated database retrieval system