KEGG   Thermoproteus tenax: TTX_0494Help
Entry
TTX_0494          CDS       T01641                                 

Gene name
tpi
Definition
Triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttn  Thermoproteus tenax
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTX_0494 (tpi)
   01230 Biosynthesis of amino acids
    TTX_0494 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_0494 (tpi)
   00051 Fructose and mannose metabolism
    TTX_0494 (tpi)
   00562 Inositol phosphate metabolism
    TTX_0494 (tpi)
Enzymes [BR:ttn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TTX_0494 (tpi)
Exosome [BR:ttn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TTX_0494 (tpi)
  Exosomal proteins of bladder cancer cells
   TTX_0494 (tpi)
  Exosomal proteins of melanoma cells
   TTX_0494 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
442870..443550
Genome map
AA seq 226 aa AA seqDB search
MRLPILIINFKAYGEAAGKRAVELAKAAERAARELGVNIVVAPNHLELGLVSQSVDIPVY
AQGADVEAGGAHTAHVSLENIKEAGGSGVILNHSEAPLKLNDLARLVAKAKSLGLDVVVC
APDPRTSLAAAALGPHAVAVEPPELIGTGRAVSRYKPEAIVETVGLVSRHFPEVSVITGA
GIESGDDVAAALRLGTRGVLLASAAVKAKDPYAKIVELAKPLSELR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttccgattctgataataaacttcaaggcatacggcgaggcggccggcaaaagg
gccgttgagttagccaaggcggccgagagagctgccagagagctcggcgtaaatatcgtt
gtggctcccaaccacttggagctgggcttggtctctcagtccgtcgacatacctgtctat
gcccagggcgccgatgtagaggcaggaggagcccacactgcacatgtgtcgctggagaac
ataaaggaggcgggcggctcaggcgtgatattgaaccacagcgaggctcctctgaagcta
aatgatctagccagactggtggccaaggccaagtccctaggcctcgatgtagtcgtgtgt
gctccagacccgaggaccagcctggcggcggccgccctggggcctcacgcagtggccgtg
gagcctccggagctcatcggcaccggcagagcggtatcgagatacaagccagaggccatt
gttgagacggtgggcctagtgtcgaggcacttccccgaggtgtccgtgataacgggcgca
ggcatagagtcgggggacgacgtggccgccgcgctgaggcttgggaccaggggggtcctg
ttggcaagcgccgccgtgaaggcgaaggacccctacgccaaaatagttgagctcgccaag
cctctgtcagagctccgctga

DBGET integrated database retrieval system