KEGG   Thermoproteus tenax: TTX_0494Help
Entry
TTX_0494          CDS       T01641                                 

Gene name
tpi
Definition
Triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttn  Thermoproteus tenax
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ttn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttn00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ttn00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ttn00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
442870..443550
Genome map
AA seq 226 aa AA seqDB search
MRLPILIINFKAYGEAAGKRAVELAKAAERAARELGVNIVVAPNHLELGLVSQSVDIPVY
AQGADVEAGGAHTAHVSLENIKEAGGSGVILNHSEAPLKLNDLARLVAKAKSLGLDVVVC
APDPRTSLAAAALGPHAVAVEPPELIGTGRAVSRYKPEAIVETVGLVSRHFPEVSVITGA
GIESGDDVAAALRLGTRGVLLASAAVKAKDPYAKIVELAKPLSELR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttccgattctgataataaacttcaaggcatacggcgaggcggccggcaaaagg
gccgttgagttagccaaggcggccgagagagctgccagagagctcggcgtaaatatcgtt
gtggctcccaaccacttggagctgggcttggtctctcagtccgtcgacatacctgtctat
gcccagggcgccgatgtagaggcaggaggagcccacactgcacatgtgtcgctggagaac
ataaaggaggcgggcggctcaggcgtgatattgaaccacagcgaggctcctctgaagcta
aatgatctagccagactggtggccaaggccaagtccctaggcctcgatgtagtcgtgtgt
gctccagacccgaggaccagcctggcggcggccgccctggggcctcacgcagtggccgtg
gagcctccggagctcatcggcaccggcagagcggtatcgagatacaagccagaggccatt
gttgagacggtgggcctagtgtcgaggcacttccccgaggtgtccgtgataacgggcgca
ggcatagagtcgggggacgacgtggccgccgcgctgaggcttgggaccaggggggtcctg
ttggcaagcgccgccgtgaaggcgaaggacccctacgccaaaatagttgagctcgccaag
cctctgtcagagctccgctga

DBGET integrated database retrieval system