KEGG   Thermoproteus tenax: TTX_0494Help
Entry
TTX_0494          CDS       T01641                                 

Gene name
tpi
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00010  Glycolysis / Gluconeogenesis
ttn00051  Fructose and mannose metabolism
ttn00562  Inositol phosphate metabolism
ttn01100  Metabolic pathways
ttn01110  Biosynthesis of secondary metabolites
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
ttn01200  Carbon metabolism
ttn01230  Biosynthesis of amino acids
Module
ttn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_0494 (tpi)
   00051 Fructose and mannose metabolism
    TTX_0494 (tpi)
   00562 Inositol phosphate metabolism
    TTX_0494 (tpi)
Enzymes [BR:ttn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TTX_0494 (tpi)
Exosome [BR:ttn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TTX_0494 (tpi)
  Exosomal proteins of bladder cancer cells
   TTX_0494 (tpi)
  Exosomal proteins of melanoma cells
   TTX_0494 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG NMO FMN_dh IGPS His_biosynth Peripla_BP_6 Smr
Motif
Other DBs
NCBI-ProteinID: CCC81161
UniProt: Q8NKN9
Structure
PDB: 

Jmol
Position
442870..443550
Genome map
AA seq 226 aa AA seqDB search
MRLPILIINFKAYGEAAGKRAVELAKAAERAARELGVNIVVAPNHLELGLVSQSVDIPVY
AQGADVEAGGAHTAHVSLENIKEAGGSGVILNHSEAPLKLNDLARLVAKAKSLGLDVVVC
APDPRTSLAAAALGPHAVAVEPPELIGTGRAVSRYKPEAIVETVGLVSRHFPEVSVITGA
GIESGDDVAAALRLGTRGVLLASAAVKAKDPYAKIVELAKPLSELR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttccgattctgataataaacttcaaggcatacggcgaggcggccggcaaaagg
gccgttgagttagccaaggcggccgagagagctgccagagagctcggcgtaaatatcgtt
gtggctcccaaccacttggagctgggcttggtctctcagtccgtcgacatacctgtctat
gcccagggcgccgatgtagaggcaggaggagcccacactgcacatgtgtcgctggagaac
ataaaggaggcgggcggctcaggcgtgatattgaaccacagcgaggctcctctgaagcta
aatgatctagccagactggtggccaaggccaagtccctaggcctcgatgtagtcgtgtgt
gctccagacccgaggaccagcctggcggcggccgccctggggcctcacgcagtggccgtg
gagcctccggagctcatcggcaccggcagagcggtatcgagatacaagccagaggccatt
gttgagacggtgggcctagtgtcgaggcacttccccgaggtgtccgtgataacgggcgca
ggcatagagtcgggggacgacgtggccgccgcgctgaggcttgggaccaggggggtcctg
ttggcaagcgccgccgtgaaggcgaaggacccctacgccaaaatagttgagctcgccaag
cctctgtcagagctccgctga

DBGET integrated database retrieval system