KEGG   Thermoproteus tenax: TTX_0565Help
Entry
TTX_0565          CDS       T01641                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00010  Glycolysis / Gluconeogenesis
ttn00620  Pyruvate metabolism
ttn00640  Propanoate metabolism
ttn00680  Methane metabolism
ttn00720  Carbon fixation pathways in prokaryotes
ttn01100  Metabolic pathways
ttn01110  Biosynthesis of secondary metabolites
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
ttn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_0565 (acs)
   00620 Pyruvate metabolism
    TTX_0565 (acs)
   00640 Propanoate metabolism
    TTX_0565 (acs)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_0565 (acs)
   00680 Methane metabolism
    TTX_0565 (acs)
Enzymes [BR:ttn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TTX_0565 (acs)
Lipid biosynthesis proteins [BR:ttn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TTX_0565 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Tautomerase
Motif
Other DBs
NCBI-ProteinID: CCC81230
UniProt: G4RNT6
Position
505469..507358
Genome map
AA seq 629 aa AA seqDB search
MEIWRPEKEHLSESNIARYISDRGLGTLDAFISFTYERPEAFWSSFVDEVLRVKWYEKYT
KVLDLSSGVQWPRWFIGGKINIADQLEDSARPLVKWEGEDGSKAVWSYSEVLYKARAVAS
WLKRNGLNKGDRVGIFMPMVPEIVPVMLGAIRAGGIIVPLFSGFGKEAIRVRLEDSEAKF
VFASDISYRRGRPIDMLSELRAGLAPSVRNVVVHERGGLRGDYVSLAEVFKTGGDYVEAA
SSEDPIMIIYTSGTTGKPKGTVHTHDGFPIKAAADVYFHFDLREGETLSWITDMGWMMGP
WMVFAAYLLRGSMAFFEGAPDYPKDRVWRFVEEHRVSALGLAATLTRYLRSIEAAAAPGQ
LDSLKAFGNTGEPIDVESWLWLYRMGRGRIPIINYSGGTEISGGILGCYVVREMKPSSFN
GMSPGIKAAVFTEDGKPAPPGTEGELVVLSVWPGMTRGFWRDPQRYLETYWSKWPGVWAH
GDAAMVDQEGFYYILGRADDTIKVAGKRLGPAEIETVLNAHPAVAESACIGVPHDIKGEV
PICFVVLKPGYEPSEELKRELIKRTEEALGKAFGAVEDIKFVKLLPKTRNAKIMRRVIRA
VYLGRNPGDLSALESPEAIEEIKRVAIKS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatggagacctgagaaagaacacctctctgaatctaatattgctagatatata
tctgatcgcgggctaggcactctcgacgcgttcatatcttttacctacgagaggcccgag
gccttctggagctccttcgtggacgaggtattgagggtgaagtggtacgaaaaatacact
aaagtgttggatctaagtagcggcgtccagtggcctaggtggtttatcgggggcaagatc
aatatagctgaccaacttgaggactcggcaagaccgttagttaaatgggagggggaagat
gggagcaaggccgtgtggagctactcagaggtgctctataaggccagagcggtggcgagc
tggctcaagagaaatgggctaaacaagggcgatagagtcggcatctttatgcccatggtg
cccgagatagtcccagtcatgctcggcgcaattagagccggcggaatcatagtgccgctc
ttcagcgggttcggcaaagaggccatcagagtgaggcttgaggacagcgaggctaagttc
gtcttcgcctcagatatatcgtacagaaggggcaggcccatcgatatgttgtctgagctg
agggcagggttggccccgtcggtccgcaacgtggtggtccacgagcggggcggtctcagg
ggcgactacgtctccctcgctgaagtctttaagaccggaggcgactacgtcgaggcggcc
agctccgaggatcccattatgataatctacacctccggcaccactgggaagcccaagggc
acagtccatacccacgacggcttccctatcaaggccgccgctgacgtctacttccacttc
gatttaagggagggagaaacgttgagctggatcaccgacatgggctggatgatgggccct
tggatggtcttcgccgcctacctcctgcgcggctccatggccttcttcgagggcgctccg
gactaccccaaggacagagtctggcggttcgtcgaagagcacagagtctctgcgctgggc
cttgcagccacgttgacaagatatctgaggagcattgaggcggccgccgcgccgggccaa
ctggatagcctaaaggcgtttggcaacacgggcgagcccatcgacgtggagagctggcta
tggctctacaggatggggagggggaggatccccataataaattattcaggcggcaccgag
atctccggaggcatcctgggatgttacgtcgtgagggaaatgaagccgagttccttcaac
ggcatgagccctggcataaaagccgccgtgttcaccgaagatggaaagccggccccgcct
ggcacagagggcgagctcgtagtcctatctgtgtggccgggcatgacgaggggcttctgg
cgcgacccccagaggtaccttgagacctactggagcaagtggcccggcgtatgggcgcac
ggcgatgccgccatggtggaccaagagggcttctactatatcctggggcgcgccgatgac
accatcaaagtcgccggcaagaggctggggcctgccgagatagagactgtgctaaacgcg
catcccgctgtggcagagtcggcgtgtattggagtgccccacgacatcaagggggaggtg
ccgatatgcttcgtggtgctcaagccaggctatgagcctagcgaggagctcaagagggag
ctcatcaaaaggaccgaggaggcgctcggcaaagccttcggcgctgtggaagatattaag
ttcgtcaaattgcttccgaagacgcgcaacgccaagattatgaggagagtgataagggcg
gtgtatttggggcgcaaccccggcgacctttccgcgttggagagcccagaggctatagag
gagataaagagagtagcaataaagagttga

DBGET integrated database retrieval system