KEGG   Thermoproteus tenax: TTX_0921Help
Entry
TTX_0921          CDS       T01641                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ttn  Thermoproteus tenax
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTX_0921 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TTX_0921 (sucC)
   00640 Propanoate metabolism
    TTX_0921 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TTX_0921 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_0921 (sucC)
Enzymes [BR:ttn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TTX_0921 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
795838..797001
Genome map
AA seq 387 aa AA seqDB search
MIPKTMKLYEYEAKEIFAKYGVKIPPGKLALSPQEVRKIAEEIGKPVVLKAQVTVAGRGK
AGGIKVAKSPQEAEELAKQMFGMNIKGLTVRKIYVTEYVEVEREMYLSLIIDRASRRYLF
LASPIGGVDIEEIAKREPEKIKRVYVDPFEGLKDFHIRGIVSWLGVKAGTQQWEQAAGIV
KAMYKAMTELEAELVESNPLAVTKSGDVIPLDARIIIDDNALYKHPDLEKAYEEDPRDVT
EFERYAQRIGFNYVELDGDIGIIGNGAGLTMSTMDLVYHYGGRPANFLDIGGGASREVVK
EALKVLLRHPRVKVIFINIFGGITRADEVAAGVEGALNELGNAGKKIIVRMKGTNEELGR
QMLAKIGVPLYESAEEAAQKAVELARI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatcccaaaaactatgaaattgtatgaatacgaagccaaagagatattcgcaaaatac
ggagtcaaaataccgccaggcaaattggctctttcaccgcaggaggttcgcaagatagct
gaggagatcggcaagccggtagtgttaaaggcccaagtcacagtggcgggcagaggaaag
gcgggcggcataaaggtggctaagtcgccgcaagaggcagaggagctggccaagcagatg
ttcggcatgaacatcaagggtcttacagtgaggaagatttacgtgaccgaatatgtggag
gtggagcgcgagatgtacttgagcctcatcatagatagagcctctaggaggtaccttttc
ctcgcctcccctataggcggcgtggacattgaggaaatagccaagagggagccggagaag
ataaagagggtgtacgtagaccccttcgagggactcaaggacttccacatcaggggcata
gtttcatggttgggcgttaaggccggtactcaacagtgggaacaagccgcgggcatagta
aaggcgatgtacaaggccatgacggagctggaggctgagttggtagaaagcaacccgctc
gctgtaacgaaatcgggcgacgttataccgcttgacgcgaggataataatcgacgataat
gcactttacaaacatccagatctagagaaggcctacgaggaggatccgagggatgtgacc
gagttcgagagatatgcccagaggatagggttcaactatgtggaacttgacggagatatc
ggcataataggcaacggcgccggcctcacaatgagcacgatggatttagtatatcactac
gggggcaggcccgcgaacttcttggatataggcggaggagcctcgcgcgaggtggtgaag
gaggcccttaaggtcttgttgaggcatccgagagtcaaggtgatattcattaatatattc
ggaggcataaccagagccgacgaagtggccgcaggcgtcgagggagccttaaacgagttg
ggcaacgctggaaagaagatcatcgtgaggatgaaggggaccaacgaggagttgggcaga
caaatgttggccaaaataggagtccctctatatgaaagtgccgaagaggcggcacaaaaa
gccgtagagttagcgaggatatga

DBGET integrated database retrieval system