KEGG   Thermoproteus tenax: TTX_0958Help
Entry
TTX_0958          CDS       T01641                                 

Gene name
pcm
Definition
Protein-L-isoaspartate O-methyltransferase 1 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ttn  Thermoproteus tenax
Brite
Enzymes [BR:ttn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TTX_0958 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828512..829162
Genome map
AA seq 216 aa AA seqDB search
MLDFTRARRRLVEDLIAEGIIKSKSVAEAMLKVPREEFVAPEYRLMAYEDSALPLIGEAT
ISAPHMVAMLCEAIRPREGMRILEVGAGSGYQAAVCAEAIGREGEIYTVEIELPLALYAT
QNIERLGYSDVVNVFYGDGTEGLPEKAPFDAIIVTAAAPRVPEALKGQLKAGGRLVIPLE
ERAGQILYLYTLSQEGVWSREKLAYVSFVKLKGKFI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctagatttcacacgagcgaggagaaggctcgtcgaagaccttatagcagagggcatt
atcaagtccaagagcgtcgctgaggctatgttgaaagtgcctagggaggagttcgtcgct
ccagaatataggctgatggcgtatgaggacagcgcccttcctctgatcggcgaggccact
atatcggccccccacatggtcgccatgttgtgtgaggcgataaggccgagggagggcatg
aggatcctcgaggtaggcgccggctcgggctatcaagcggcagtctgcgctgaggccatc
ggaagggagggagagatctacactgttgagatcgagctccccctcgccttatatgcgacg
cagaacatcgaaaggttgggctacagcgatgtggttaacgtcttctatggagacggcacc
gagggtctgcccgaaaaggcgccgttcgacgccataatagtgacggcagctgctccgcgt
gtcccagaggcgctgaaaggccagctgaaggcgggaggaagactggtcataccccttgaa
gagagagccggccagatcctctatctatatactttgtctcaagaaggtgtttggtctaga
gaaaaattagcttatgtatctttcgtaaaattaaaaggaaaatttatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system