KEGG   Thermoproteus tenax: TTX_1027Help
Entry
TTX_1027          CDS       T01641                                 

Gene name
frvX
Definition
cellulase M-like protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ttn  Thermoproteus tenax
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTX_1027 (frvX)
Enzymes [BR:ttn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TTX_1027 (frvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
885564..886652
Genome map
AA seq 362 aa AA seqDB search
MQDFKALLKRLSEAFGPSGFEDEVRDLVIEEMRPYVDQIFVDKWGNVYGVKKGRTEYRAM
VAAHMDEIGLVVDHVEKSGFLRVKPVGGWNEVTLVGQRVIIKARDGRKIRGVVGTRPPHI
TPPGKEREAPEMKDLFIDIGASSAEEVAKLGVEVGSVAVLDREFVDLAYDVVTGKAFDDR
VGLAVMLYTLRQLDDIPVTLYAVATVQEEVGLRGASIAAERVNPHYAIALDTTVASDVPG
ASERDYVARVGKGPAIKVLDGGRAGLFIAHPRLRDFIVEVARREGIPHQLEVLYGGTTDA
LAIAFRREGVPAATISIPTRYIHSPVEVLKVDDAVNASKLLAATIRNSDSNFIESLLEKH
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacttcaaggcactgctcaaaaggctatccgaggccttcggcccctcgggcttt
gaggacgaggtccgcgacctagttatagaagagatgaggccctacgtggaccagatattc
gtggacaagtggggcaatgtgtacggcgtgaagaagggacgcacggaataccgagcaatg
gtggccgcccacatggacgagataggcctcgtagtagaccacgtagagaagagcgggttc
cttcgcgtgaagcctgtaggggggtggaacgaagtgactctggtcggccaaagggttata
ataaaggccagagatggaaggaagatcagaggagtggtcggcactagaccgccccacata
acgccgcccggcaaagagagagaggcccccgagatgaaggacctcttcatcgacataggc
gcctcgagcgccgaggaggtagcaaagctgggcgtagaggtggggtcggtggctgttttg
gatagggagttcgtcgacttggcctacgacgtcgtgaccggcaaggcgttcgacgacaga
gtgggccttgccgtgatgctctatacccttaggcagttggacgatatacctgtgactctc
tatgcagtggcgaccgtgcaggaggaggtcggcttaaggggcgcatcaatagcggcggag
cgcgtgaacccccattacgctatcgcgttggacactacggtggcctcggacgtgcccgga
gcctctgagagggactacgtggccagagtgggcaaggggcctgcgatcaaggtcctagac
ggcggaagggccgggctcttcatcgcccatccgaggctcagagacttcatagtggaagtg
gccaggagggagggtataccgcaccagctcgaggtcctatacggcggaaccaccgacgct
ctggctatagcctttagacgggagggcgtgccggcggccacaatatctattcccactcgc
tatatccactcgcctgtggaggtgctcaaagtggacgacgcagtcaatgcctccaagctg
ctcgccgcaacaattagaaacagtgattctaactttatagaatctctactagaaaaacat
ataaaataa

DBGET integrated database retrieval system