KEGG   Thermoproteus tenax: TTX_1027Help
Entry
TTX_1027          CDS       T01641                                 

Gene name
frvX
Definition
(GenBank) cellulase M related protein
Organism
ttn  Thermoproteus tenax
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
885564..886652
Genome map
AA seq 362 aa AA seqDB search
MQDFKALLKRLSEAFGPSGFEDEVRDLVIEEMRPYVDQIFVDKWGNVYGVKKGRTEYRAM
VAAHMDEIGLVVDHVEKSGFLRVKPVGGWNEVTLVGQRVIIKARDGRKIRGVVGTRPPHI
TPPGKEREAPEMKDLFIDIGASSAEEVAKLGVEVGSVAVLDREFVDLAYDVVTGKAFDDR
VGLAVMLYTLRQLDDIPVTLYAVATVQEEVGLRGASIAAERVNPHYAIALDTTVASDVPG
ASERDYVARVGKGPAIKVLDGGRAGLFIAHPRLRDFIVEVARREGIPHQLEVLYGGTTDA
LAIAFRREGVPAATISIPTRYIHSPVEVLKVDDAVNASKLLAATIRNSDSNFIESLLEKH
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacttcaaggcactgctcaaaaggctatccgaggccttcggcccctcgggcttt
gaggacgaggtccgcgacctagttatagaagagatgaggccctacgtggaccagatattc
gtggacaagtggggcaatgtgtacggcgtgaagaagggacgcacggaataccgagcaatg
gtggccgcccacatggacgagataggcctcgtagtagaccacgtagagaagagcgggttc
cttcgcgtgaagcctgtaggggggtggaacgaagtgactctggtcggccaaagggttata
ataaaggccagagatggaaggaagatcagaggagtggtcggcactagaccgccccacata
acgccgcccggcaaagagagagaggcccccgagatgaaggacctcttcatcgacataggc
gcctcgagcgccgaggaggtagcaaagctgggcgtagaggtggggtcggtggctgttttg
gatagggagttcgtcgacttggcctacgacgtcgtgaccggcaaggcgttcgacgacaga
gtgggccttgccgtgatgctctatacccttaggcagttggacgatatacctgtgactctc
tatgcagtggcgaccgtgcaggaggaggtcggcttaaggggcgcatcaatagcggcggag
cgcgtgaacccccattacgctatcgcgttggacactacggtggcctcggacgtgcccgga
gcctctgagagggactacgtggccagagtgggcaaggggcctgcgatcaaggtcctagac
ggcggaagggccgggctcttcatcgcccatccgaggctcagagacttcatagtggaagtg
gccaggagggagggtataccgcaccagctcgaggtcctatacggcggaaccaccgacgct
ctggctatagcctttagacgggagggcgtgccggcggccacaatatctattcccactcgc
tatatccactcgcctgtggaggtgctcaaagtggacgacgcagtcaatgcctccaagctg
ctcgccgcaacaattagaaacagtgattctaactttatagaatctctactagaaaaacat
ataaaataa

DBGET integrated database retrieval system