KEGG   Thermoproteus tenax: TTX_1102Help
Entry
TTX_1102          CDS       T01641                                 

Definition
(GenBank) 4-hydroxybutyryl-CoA dehydratase
  KO
K14534  4-hydroxybutyryl-CoA dehydratase / vinylacetyl-CoA-Delta-isomerase [EC:4.2.1.120 5.3.3.3]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00650  Butanoate metabolism
ttn00720  Carbon fixation pathways in prokaryotes
ttn01100  Metabolic pathways
ttn01120  Microbial metabolism in diverse environments
ttn01200  Carbon metabolism
Module
ttn_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TTX_1102
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_1102
Enzymes [BR:ttn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.120  4-hydroxybutanoyl-CoA dehydratase
     TTX_1102
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.3  vinylacetyl-CoA Delta-isomerase
     TTX_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-ProteinID: CCC81745
UniProt: G4RJK0
Position
953276..954772
Genome map
AA seq 498 aa AA seqDB search
MGLRTGDQYVEGLRRRKHVEVYVLGKLVEDVTTHPFLKPSVKAFKATFDAAFDEDTRALA
RVKSPFIGEEINRFVHIHQGPEDLVAKVKLLRKLSHKVGTCFQRCVGWDALNTMYIVTGK
LAEREGKKVYFERFVEYLKYVQKNDLALAGAMTDVKGVRSLRPHEQPNKDAYVHVVEERG
DGIVVRGAKANITGVAVVDEVVVMPTRAMTEKDAEYAVAFAIPLDTPGVKVVVGRQVNDL
RRFEGEIDGLPYLFNHEGLVIFEDVFVPWERVFFYKEWKHSGELVEIFASFHRQGYAGCK
SGLGDVIIGASFNLARQLGIADKPHVQEKLTEMVFLNETMYSAGLAASWEGRKLLKDGGW
WVNPMFANITKHLVARFPYEIARLSHDIAGGIIATGPSEADLKNPDLRKLIEKYIQGVPE
FTAEDRLRMVRLLENISLSAAYLVESVHGAGSPQAQRISIQRLYDLQKAEMIARRLAGMT
NAQLDQKVEPHKPSDAER
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggattaaggacgggggatcagtatgtggagggcctccggaggaggaagcacgtcgag
gtctacgtcttgggcaagttggtggaggatgtaacgacgcacccgttcctgaagccgtcg
gtcaaagcctttaaggcgacattcgatgcagccttcgatgaagacacgcgggctctggcc
agagtaaagagcccgttcataggcgaggagataaacagattcgtccacatacatcagggg
cccgaggatcttgtggcgaaggttaaactgttgaggaagctgagccacaaggtggggacg
tgcttccagaggtgtgtgggctgggacgccctcaacaccatgtatatagtcacgggcaag
ctcgccgagagggagggcaagaaggtctacttcgagagattcgtcgagtatctgaagtac
gtccagaagaacgacctggcgctggcgggggctatgactgacgtcaagggagtaagatcg
ctgaggccccacgagcagcccaacaaggacgcctatgtccacgttgttgaggagaggggc
gacgggatagtggtcagaggcgccaaggccaatataacgggggtcgccgtagtggacgag
gtagtcgtcatgcccacgagggctatgacggagaaggacgctgagtacgccgtggccttc
gcaatccctctggacacgccgggcgtcaaagtcgtcgtggggagacaagtcaacgacctc
aggaggttcgagggggagatcgacggcctgccctatctgttcaaccacgaggggctggtg
atattcgaggacgtgttcgtcccctgggagagagtcttcttctataaggagtggaaacat
tcgggggagcttgtggagatattcgcaagcttccacagacagggctacgccggatgcaag
tcggggctcggcgatgtcataataggcgcttcgttcaatctagctagacagctcggcatc
gccgacaagccccacgtccaggagaagctcaccgagatggtgtttctgaacgagactatg
tactccgcaggcctcgcggcgagctgggaggggaggaagctgttgaaggacggaggctgg
tgggtcaaccccatgttcgccaatataactaaacatctggtggcgaggttcccctacgag
atagccagactctcccacgacattgccggaggcattatcgccacgggacccagcgaggcg
gatctcaagaaccccgatctgaggaagctaatcgagaaatatatacaaggagtgccggag
tttacggccgaggacaggctgcggatggtgcgcctgttggagaacataagcttgagcgcc
gcctacctcgttgagtctgtccacggcgccggcagcccccaggctcagcgtatatctatc
cagaggctctacgatcttcagaaggccgagatgatagccagacgcctcgccggtatgacc
aacgcccagctggatcaaaaggtcgagccccacaagccctcggacgcagaaagatga

DBGET integrated database retrieval system