KEGG   Thermoproteus tenax: TTX_1102Help
Entry
TTX_1102          CDS       T01641                                 

Definition
4-hydroxybutyryl-CoA dehydratase
Orthology
K14534  
4-hydroxybutyryl-CoA dehydratase / vinylacetyl-CoA-Delta-isomerase [EC:4.2.1.120 5.3.3.3]
Organism
ttn  Thermoproteus tenax
Pathway
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ttn01200]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ttn00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:ttn00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
953276..954772
Genome map
AA seq 498 aa AA seqDB search
MGLRTGDQYVEGLRRRKHVEVYVLGKLVEDVTTHPFLKPSVKAFKATFDAAFDEDTRALA
RVKSPFIGEEINRFVHIHQGPEDLVAKVKLLRKLSHKVGTCFQRCVGWDALNTMYIVTGK
LAEREGKKVYFERFVEYLKYVQKNDLALAGAMTDVKGVRSLRPHEQPNKDAYVHVVEERG
DGIVVRGAKANITGVAVVDEVVVMPTRAMTEKDAEYAVAFAIPLDTPGVKVVVGRQVNDL
RRFEGEIDGLPYLFNHEGLVIFEDVFVPWERVFFYKEWKHSGELVEIFASFHRQGYAGCK
SGLGDVIIGASFNLARQLGIADKPHVQEKLTEMVFLNETMYSAGLAASWEGRKLLKDGGW
WVNPMFANITKHLVARFPYEIARLSHDIAGGIIATGPSEADLKNPDLRKLIEKYIQGVPE
FTAEDRLRMVRLLENISLSAAYLVESVHGAGSPQAQRISIQRLYDLQKAEMIARRLAGMT
NAQLDQKVEPHKPSDAER
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggattaaggacgggggatcagtatgtggagggcctccggaggaggaagcacgtcgag
gtctacgtcttgggcaagttggtggaggatgtaacgacgcacccgttcctgaagccgtcg
gtcaaagcctttaaggcgacattcgatgcagccttcgatgaagacacgcgggctctggcc
agagtaaagagcccgttcataggcgaggagataaacagattcgtccacatacatcagggg
cccgaggatcttgtggcgaaggttaaactgttgaggaagctgagccacaaggtggggacg
tgcttccagaggtgtgtgggctgggacgccctcaacaccatgtatatagtcacgggcaag
ctcgccgagagggagggcaagaaggtctacttcgagagattcgtcgagtatctgaagtac
gtccagaagaacgacctggcgctggcgggggctatgactgacgtcaagggagtaagatcg
ctgaggccccacgagcagcccaacaaggacgcctatgtccacgttgttgaggagaggggc
gacgggatagtggtcagaggcgccaaggccaatataacgggggtcgccgtagtggacgag
gtagtcgtcatgcccacgagggctatgacggagaaggacgctgagtacgccgtggccttc
gcaatccctctggacacgccgggcgtcaaagtcgtcgtggggagacaagtcaacgacctc
aggaggttcgagggggagatcgacggcctgccctatctgttcaaccacgaggggctggtg
atattcgaggacgtgttcgtcccctgggagagagtcttcttctataaggagtggaaacat
tcgggggagcttgtggagatattcgcaagcttccacagacagggctacgccggatgcaag
tcggggctcggcgatgtcataataggcgcttcgttcaatctagctagacagctcggcatc
gccgacaagccccacgtccaggagaagctcaccgagatggtgtttctgaacgagactatg
tactccgcaggcctcgcggcgagctgggaggggaggaagctgttgaaggacggaggctgg
tgggtcaaccccatgttcgccaatataactaaacatctggtggcgaggttcccctacgag
atagccagactctcccacgacattgccggaggcattatcgccacgggacccagcgaggcg
gatctcaagaaccccgatctgaggaagctaatcgagaaatatatacaaggagtgccggag
tttacggccgaggacaggctgcggatggtgcgcctgttggagaacataagcttgagcgcc
gcctacctcgttgagtctgtccacggcgccggcagcccccaggctcagcgtatatctatc
cagaggctctacgatcttcagaaggccgagatgatagccagacgcctcgccggtatgacc
aacgcccagctggatcaaaaggtcgagccccacaagccctcggacgcagaaagatga

DBGET integrated database retrieval system