KEGG   Thermoproteus tenax: TTX_1294Help
Entry
TTX_1294          CDS       T01641                                 

Gene name
aor-2
Definition
aldehyde ferredoxin oxidoreductase 2 (EC:1.2.7.-)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ttn  Thermoproteus tenax
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTX_1294 (aor-2)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TTX_1294 (aor-2)
Enzymes [BR:ttn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TTX_1294 (aor-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1134611..1136428)
Genome map
AA seq 605 aa AA seqDB search
MPVRLTVLVVDLGTKTARRLALERETALFIGGRGIATYLFWRFGGHRLEPAEAPLIMASG
PLTGTGVPMSSRAAAVFRSPLTGILGASNVGGRLGPAMRYSGVDALVIVGRSERPSYLLI
QDGGAEVRDAADLWGKDAIETEEILTREHGRRAAVAAIGPAGENLVKFASINHDLWRQFG
RTGGGAVMGYKRLKAIVFVPDKRDVDVAHRERLEEFLRDFTPRFIGDKSVKSLFEAGTLR
LVELGNIMGFFPSYYWGQTSADGWERLAWPTLRSYLLRPAACLHCPAACHRLVRSGKYGV
SVDLDYETVFALGGLVGCFDPDEVIKLNDLADRLGMDTISLGNVVAFAVEASRLGKLPPL
EWGCDTAERLAVDIAYRRGLGDLLAEGVAAAAAKIGAREIAVHVRGLEPAGYDPRALKGM
ALGYAIGYRGADHLATMAYAIDYAGMAGGPQSLGDEKIHAVAHMEEVAAIMDSLVLCKFG
RGVYDLYPGGRGLETIARLLSDVTGDGWTAGLVRESALRVINLTRALNVMMGDPGDGLPE
RWYKPVKFGDRILQLNREEVEDALRKYYELRGWDERGLPRPAALSELGLGEVAEELRRLS
TPSKE
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgcgcctcaccgttttagttgtggacttgggcacaaaaactgcgagaaggttg
gccctcgagcgcgagactgccctctttataggcggaagggggatagccacatatctgttt
tggaggtttgggggccacagattggagccggcggaggcccccttgataatggcctcgggc
cctctgacgggcaccggcgtccccatgtcgagcagggcggccgcggtgttcagatcgccg
ttgacgggcattctgggcgcctccaacgtgggagggcgcttgggccctgcgatgagatac
agcggggtagacgcgttggttatagtgggccgctccgagaggccgtcctatttattgata
caagatggaggagccgaagtgagagatgcggcggacctgtggggtaaagacgccattgag
accgaggagatcctcacgagggagcacgggaggagggccgctgtagcggccatagggccg
gcgggggagaacttggtcaagttcgcgtcgataaaccacgacctctggcgccagttcggg
cggacgggcggcggcgcagtgatggggtacaagcggctgaaggcgatagtcttcgtgccg
gacaagagagatgtcgatgtggcacatagagagaggctggaggagttcctgagagatttc
acgccgcgcttcataggagataaaagcgtgaagtccctcttcgaggccggcactttgagg
ctggtggagctggggaacatcatgggcttcttcccgagctactactggggacagacgtcc
gccgatgggtgggagaggctggcgtggccgacgctgaggtcgtacctcctaaggccggca
gcatgtctacattgccctgcggcgtgccacagactcgtcagatcgggaaaatacggcgtg
tcggtcgacctcgactacgagactgtgttcgccttgggagggctcgtcggatgtttcgac
ccagatgaggtgatcaagctgaacgacctggccgaccgccttgggatggacacaataagt
ctggggaacgtcgtggccttcgccgttgaggcctccagattgggcaaactgccgcctctg
gagtgggggtgcgacacggccgagaggcttgcagtggatatagcgtacaggagaggtctc
ggcgatctgttagcagagggagtggcggcagcggcggccaagataggagctcgcgagatc
gcagtccacgtcagagggctggagccggcgggctacgacccgagagctctgaagggcatg
gctctaggctacgccataggctatcggggcgccgaccacctcgccactatggcctacgcc
atcgactacgccgggatggccggaggcccgcagagcttgggagatgagaagatacatgcc
gtggcgcacatggaggaggtcgcagctataatggactccctcgttttgtgtaagttcgga
cgcggcgtctacgatctctatcccggaggcagaggcctcgagactatagcgcggctgctc
tccgacgtcacaggcgatgggtggaccgccggtctggtcagagaatcggcgctgagggtt
ataaatttgacgagagccctcaacgtaatgatgggcgaccctggggatgggctacctgaa
aggtggtataagcctgtgaaattcggcgataggattctacagctgaatagagaggaggtg
gaggacgcgttgaggaagtactacgaactaagagggtgggacgaacgcggactccccagg
cccgccgctctgtccgagctcgggctcggcgaggtggcggaggagctccgacggctgtcg
acgccgtctaaagaataa

DBGET integrated database retrieval system