KEGG   Thermoproteus tenax: TTX_1316Help
Entry
TTX_1316          CDS       T01641                                 

Gene name
glcB
Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00620  Pyruvate metabolism
ttn00630  Glyoxylate and dicarboxylate metabolism
ttn01100  Metabolic pathways
ttn01110  Biosynthesis of secondary metabolites
ttn01120  Microbial metabolism in diverse environments
ttn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTX_1316 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    TTX_1316 (glcB)
Enzymes [BR:ttn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TTX_1316 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CCC81953
UniProt: G4RK58
Position
complement(1156973..1159420)
Genome map
AA seq 815 aa AA seqDB search
MVIEINKEVLKKFPELFGEKTVNGRRVVVEELIERLTRELRAEIDKAVRARREWLNDRRP
VREKAAFPQWDQRFVDADGNVRTFREIVQGLIDNFLGRDTPLRWGLNWNTPVPDDLHPLK
NPGLEITGPWHPMSRAIHQINADVVSMMEDEEDASPAWFIPRGSGRTVAAVWEARRIVKR
VLEGDIPTPYVEGGKTYYLKKERSKWPTLIHRVPGLHILDFDIRVDGRPAPAIITSIVIY
TVNNYEALKRAGSGVYFYVPKTQTPEEALVIEKILRRVEDELGLRRGEIKLAMLYEEARA
GLYLPVIFWIWRERLVKSNNGRWDYLGSLIEMWKDEAVYPDPQNITMTHPIMMAYQKYNA
LLCLMAGLDREGKLNAGPVGGMAAVMLYRQDDPYQRNRYNARALRAIWLDKLRERLIGLV
FVTEDAVGKVTLDDVLKGRVRGRLYDLFRQSWVATPEESYVKAGNEPLKASLEELQAMIN
RPVKFVEVDGVKIPAVDSGLTEQERQLFQRLGLIDENGNITPWVIRPDMLDSPEKLFNNR
ELWGGRDLWSALYEPPKGDITIEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFMND
LATYRIFSTWLWTLLRHKARITKDGALKGPARTHLGVIPAEDRVRVPAGAQFTEELFEKL
WDLHMEWTYAFYDDLDRISAERILLRFTESVKGALREAYKAGPFRFQSPAETAKRISESI
KAEDLERAVVENQPRFDRSFAPVIMDILRAKLTSPMYLQHSGRLIMALAPLPDEERGAVL
QAMFSPREEVERLVKEGRLKPYVLELYDYVYDIRP
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggtaattgaaataaataaggaagtattaaaaaaattccctgaattgttcggcgagaaa
actgtaaatgggcggagagttgtagtagaggagttgatagagcgtttgacgagggagctc
cgcgccgagatagacaaggcagttagggcgaggagggagtggctcaacgatagaaggcct
gtgcgggagaaggcggcgttcccccagtgggaccagaggttcgtcgacgccgacggaaac
gtaagaaccttcagagagatcgtgcagggcttgatcgacaacttcttgggccgggacacg
ccgttgaggtggggcctcaactggaacacgcctgtgcccgacgatctacacccgctcaag
aacccggggctcgagatcacggggccttggcaccccatgagcagagcgatccaccagata
aacgccgacgtcgtctccatgatggaggacgaggaggacgcgagccccgcctggttcatc
ccgcggggatccggcagaactgtcgcggctgtgtgggaggccaggaggatagtgaagagg
gtgttggagggagatataccgacgccctacgttgagggaggcaagacgtactatctaaag
aaggagaggtccaagtggccgactctcatccacagagtgcccgggctccacattctggac
ttcgacatcagagtcgacgggaggcccgcccccgccataatcacatccatagtgatatac
acagtgaacaactacgaagcgctgaagagggccggctctggcgtctacttctacgtcccg
aagacgcagacgcccgaagaggcgttggtcatagagaagatcttgaggcgcgtcgaggac
gagctggggctgaggaggggcgagataaagctggccatgttgtacgaggaggccagagcg
gggctctacctccccgtgatcttctggatatggagggagaggctcgtcaaaagcaacaac
ggccggtgggactacttgggctccctgatagagatgtggaaggacgaggcggtgtaccca
gatccccagaacatcacgatgacccaccccattatgatggcctaccagaagtacaacgcg
ctcctctgcctaatggcgggtttggacagagaagggaagctcaacgccggacctgtgggc
ggaatggccgcagtgatgttgtacagacaggacgacccctatcaacgcaacagatacaac
gcgagggctctgagggccatatggctggacaagcttagagagcgcctcataggcctggtc
ttcgtcacagaggatgccgtgggcaaggtgactctcgacgatgtgctcaaggggagggtc
agaggcaggctctacgacttgttcagacagagctgggtagcgacgcccgaggagtcctat
gtgaaggccggcaacgagccgttgaaggccagcctggaggagctacaggcgatgataaac
aggcctgtgaagttcgtggaggtcgacggcgttaaaatcccggctgtcgacagcggtctg
acggaacaagagaggcagctcttccagaggctcgggcttatagacgaaaacggcaacatc
acgccgtgggtgatacgcccggacatgttggacagcccggagaagctcttcaacaaccgg
gagctgtggggagggagggacctctggtccgccctctacgagccccccaagggcgatata
acgatcgagcacatacaacacgccttctatatggcggccaactacggcttccagcttctt
aacggcaatctggcggcggccatagacgactacgagctgggccagaggtttatgaacgac
ctagcgacgtaccgcatcttctccacatggctctggactctcttgagacacaaggcgcgt
ataactaaggacggcgcactgaaggggccggccaggacgcacctcggcgtaataccggcc
gaggacagagtcagagttcccgccggtgcccagttcaccgaggagctcttcgaaaagctc
tgggatctacacatggagtggacctacgccttctacgacgatttggacagaatatcggcc
gagaggatactgctgcgatttacggagagcgtcaaaggcgcgttgcgcgaggcctacaag
gctgggccgttcagattccagtctcccgccgagactgccaagaggatctctgagtcgatc
aaggcggaggatctggagagggccgtggtggagaaccagcccagattcgacagatcgttc
gcccccgtcattatggacattctgagggcaaagctgacctctccgatgtatttgcaacac
agcggccgcctcatcatggcgctggcgcctctgccggacgaggagaggggcgccgtgcta
caagcaatgttctccccgagggaggaagttgagaggcttgtgaaagagggcaggctgaag
ccgtacgtccttgagctatacgactacgtatacgacataaggccgtga

DBGET integrated database retrieval system