KEGG   Thermoproteus tenax: TTX_1396Help
Entry
TTX_1396          CDS       T01641                                 

Gene name
for
Definition
formaldehyde ferredoxin oxidoreductase (EC:1.2.7.-)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ttn  Thermoproteus tenax
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTX_1396 (for)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TTX_1396 (for)
Enzymes [BR:ttn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TTX_1396 (for)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1230311..1232143)
Genome map
AA seq 610 aa AA seqDB search
MPGWQGRILRVDLTRRKFVVQELDASIARDFIGGRGLAIKILWDELPPGTDPLSPHNKLI
FAAGPLTGLTNVNTGKLVVAAKSPITGGYGDGNIGAWAGVYMRRAGYDAIVVEGRANKPT
YLYIDERGVEFHDASDLWGLNTWATEDKLQKIHGRDAGVLTIGPAGERLVKYAVVVAQRG
RAGGRPGMGAVMGSKNLKAVVVKGKGEIPVADKAINKIGIEAVEQGRKMPGYSFWMKQGT
TSTVEWAQEASVLPTYNFSEGQFDEFEKIGGAMVEKMEVDLKSCPLCFMPCGHWVPSEEG
TAEVDYENIALLGSNLGIGDLSKVAELNRVADLMGMDTISLGNTLGFAMEASERGLTKEF
GYKIEWGDYKAARELAIDIALRRGFGDLLAEGTMRASQRLGKGAEELAVQVKGLEVSGYD
CHAAPAMALAYATSPIGPHHKDAWVISWEVKTDRLGYTREKAAKVIELQRIRGGWFEAFV
ACRLPWVEVGLSLDWYPKLFKAATGIDATPDYFNEVGDRIYALIRAFWIREYGYWSRELD
VPPPKWFKRPLTKGPLKGAHLDYDKYNELLSHYYDLRGWGQNGVPRRSTLKRLGLAHVAE
TLEKYVEVPD
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcctggatggcaagggaggatcctcagagtggacctcactagaaggaagttcgtcgta
caagagctggacgcctctattgcgagggacttcataggggggagggggcttgcgataaag
atattgtgggacgagcttcccccaggcacagatccgctctcgccgcacaacaaactcata
tttgccgccgggccgttgacaggtttgacaaacgtcaatacgggcaagttggttgtcgcc
gccaaatcgccaatcaccggcggatacggcgatggcaacataggggcctgggccggagtc
tatatgaggagggccggctacgacgctatagttgtagaaggtagggcgaataaacctaca
tatctctatatagatgagaggggagtagagttccacgacgccagcgacttgtgggggctc
aacacgtgggccaccgaggacaaactacagaagatacacggaagggacgccggcgtcttg
accatagggccggcgggcgagaggcttgttaaatacgctgtggtcgtggcccagaggggg
agggccggaggcaggccgggaatgggcgccgtgatgggttccaagaacttaaaggcggtg
gtggtcaagggcaagggcgagatacccgtggccgataaggcgataaacaaaataggtata
gaggccgttgaacaagggaggaagatgcccggctacagcttctggatgaagcaaggcact
acatctacagttgaatgggcgcaggaggccagcgttctcccaacatataacttctcggag
ggccagttcgacgagtttgagaaaataggaggggccatggtggagaaaatggaggtcgac
ctcaagtcgtgccctctatgtttcatgccctgcggacattgggtaccctccgaggagggc
accgctgaggtcgactacgagaacatagctctgttgggctccaacttgggcatcggagat
ttgtcgaaggtcgccgagctgaaccgcgtggcggacttaatgggcatggacactatatct
ctcggcaacactctcggcttcgccatggaggcaagcgagaggggtttgacgaaggagttc
ggctacaagatagagtggggcgattacaaggccgcccgcgagctggccatcgacatagct
ctcaggaggggcttcggagatctcctcgccgagggcaccatgagagcctcgcagaggttg
ggaaagggcgcagaggagctggcggtgcaagtcaagggcctcgaggtgagcgggtacgac
tgccacgcagctcccgccatggcgcttgcctacgccacctcgcccataggcccccatcac
aaggacgcatgggtcatctcgtgggaggtcaagacggaccgcctcggatatacgagggaa
aaggccgcaaaagtgatagagctacagaggattagaggcggttggttcgaggcgttcgtg
gcatgccgtctgccctgggtcgaggtgggcttgtctttagactggtatcccaagctcttc
aaggcggcgacaggtatcgacgcgacccccgactacttcaacgaggtcggcgacagaata
tacgcgctgataagggcgttctggataagggagtacggctactggagccgggaattggat
gtgccgccccccaagtggttcaagaggcctctcacgaagggcccgctgaagggcgcacac
ttagactacgacaaatacaacgagctcttgagccactattacgacttgaggggctggggc
cagaacggagtgccgaggaggagcactttgaagaggctggggctcgcgcacgtcgcagag
accctcgagaaatacgtggaggttcccgactag

DBGET integrated database retrieval system