KEGG   Thermoproteus tenax: TTX_1399Help
Entry
TTX_1399          CDS       T01641                                 

Gene name
amyA
Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
ttn  Thermoproteus tenax
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTX_1399 (amyA)
Enzymes [BR:ttn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TTX_1399 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1234516..1235886
Genome map
AA seq 456 aa AA seqDB search
MDIVLFFEVHQPYRLRPDLHRVFPREPSFEELFYSEFDSAVFSRVAERVYRKATKIILEA
SREVPLKVTFSVSGLALEQIRRWAPDVLELLRELAARGVAEFVAQTYYHSLAWLIDLREF
KEQVALQIKAVEELIGYRPTAAENTEFIYNNDVACAFAEMGFKAVATEGVDWVLGWRSPN
YVYRSWGCDVRVLTRNYRLSDDVGFRFGARWWDQWPLTADKYAAWLDATPGDVVLIAVDY
ETFGEHHWPESGIHEFLRWLPREVSKRPRLKFATLTEAALRNPPRDVYDVPPWATISWAD
ERDLSAWLGNEMQRNAFSVLRWLYPYARALGGDALRLWRLLSTSDHFYYQATKSGPAGEV
HSYFSPYGSAYKAHDIYMNALAVLLSVIREKWRPQDAERLVFNDERCFHSEGVRLCSLGD
LKRTDVEFKRRHKEDLMRWLTDVFLLDEASAEALLK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggatatagtactgttcttcgaggtgcatcagccatatcgcctccgcccagacctccac
agagtcttcccgagggagccctcctttgaggagctcttctattcagagttcgactcagcc
gtcttctcccgcgtcgccgagagagtataccggaaggccaccaagataatccttgaggcg
tctagggaggtcccgctcaaggtgacgttcagcgtgagcggcctcgcgttggagcagata
aggcgttgggcccccgacgtcttagagctcctcagagagctcgccgctagaggcgtggcg
gagtttgttgcacagacctactaccacagcctagcgtggttgatagacctaagggagttt
aaagagcaggtggcactgcagatcaaggcagtggaggagttgatcggctataggcccacg
gcggcagagaacaccgagttcatatacaacaacgacgtagcttgcgccttcgctgagatg
ggcttcaaggcggttgccacagagggcgtggactgggtcttaggctggcgctcgcccaac
tacgtatacagatcgtggggctgcgacgtgagggtgctgacgcgaaactaccggctcagc
gacgacgtgggattcagattcggcgcaaggtggtgggaccagtggcctctcaccgccgac
aaatacgccgcttggctcgacgcaactccgggcgatgtcgtcctcatagctgtggactat
gagactttcggcgaacaccactggcctgaatcaggtatccatgaattcctccgctggctc
cccagagaggtctccaaaaggccgcgcctcaagtttgcgacgctcaccgaggcagcactg
aggaacccccctcgcgacgtctacgatgtaccgccctgggcgacgataagttgggcagat
gagcgcgacctttcggcatggctgggcaacgagatgcagaggaacgcgttctcggtcctc
cggtggctttacccctacgcgagggccctcggaggagacgccttgaggctctggaggctt
ctgtccactagcgaccacttttactatcaagcgactaagtctggacctgccggcgaggtt
cactcctatttctccccctatggctcagcctataaggcgcacgacatatacatgaacgcg
ctggccgtgctcctctcagttataagggagaagtggcgcccgcaagacgcagagaggctt
gtgttcaacgacgagaggtgcttccactcagagggcgtccgcctctgttctctcggcgat
ctcaagaggacggacgttgagttcaaacgccggcataaggaggaccttatgaggtggctc
acagacgtcttcttgttggacgaggcctcagctgaggcgctcttgaagtga

DBGET integrated database retrieval system