KEGG   Thermoproteus tenax: TTX_1402Help
Entry
TTX_1402          CDS       T01641                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ttn  Thermoproteus tenax
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTX_1402 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTX_1402 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTX_1402 (trpA)
Enzymes [BR:ttn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TTX_1402 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1238746..1239480
Genome map
AA seq 244 aa AA seqDB search
MRLPKPGLGVYITAQWPNSETFRSLLSSLDQVADFVEIGVPTTNPKYDGPFIRLSHREAA
VKGLGALQGLDLPKNAVLMAYAEDYLGKFDALARAAAESGAVSVLLPDLLVDFPEALEEY
VLAVRRNGLDPSFFLPSKFPYALAGRLASYNPLFLYIGLYAATGIRLPVYVERNIKIARQ
YAGDVYIVAGFAIDSADRARAIVGAGADGLVVGTAAMKILKERGLQQTLAFLAEIKEALR
SLNI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtctgcccaagccaggcctcggcgtctatataaccgcccagtggcccaactctgag
acttttcggagcctcctgagctccctcgatcaagtcgcagactttgttgaaataggcgtg
cccacgacaaatcctaagtacgatgggcccttcattaggttgagccacagagaggctgcc
gtcaaaggcttgggcgctctgcagggtctagacttgcccaagaacgccgttctgatggcc
tacgccgaggactacctaggcaaattcgatgcgctggcgcgggccgctgcagagtcgggg
gctgtctccgtgttgttgcccgaccttttggtggacttccctgaggcattggaggagtac
gtattggctgtgaggaggaacggcctcgaccctagcttctttctgccgagcaagttcccc
tacgcgctcgcggggagactcgcctcctacaacccactctttttgtatataggtctctac
gccgcaacgggcatacggctgcccgtctatgtggagaggaacatcaaaatagcgaggcag
tacgcgggggacgtgtacatagtcgctggattcgccatagacagcgccgatagagcgagg
gccattgtaggcgccggcgcggacgggctcgtcgtgggcaccgccgccatgaagatcctc
aaggagcggggtctccaacagactctggcctttcttgccgagattaaggaggcgttacgc
tctctcaatatttaa

DBGET integrated database retrieval system