KEGG   Thermoproteus tenax: TTX_1555Help
Entry
TTX_1555          CDS       T01641                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ttn  Thermoproteus tenax
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ttn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1368151..1369173)
Genome map
AA seq 340 aa AA seqDB search
MLLNLAYPSVRPRRLRANKLIRDAVAETSLSPDDLIMPIFVKEGSSIEHIESMPGYFRWP
VGSELVKHVEEALNLGVNKFILFGVLPDDIKDPEGRAGYDPEGVVPKALRLLKETFGDRV
LLFADVCLCEYTDHGHCGIVVYDKKGWKIDNDKTISIYAKEAVTYAEAGADFVAPSGMMD
GQVRAIRQTLDSAGYTDVGIMAYSAKYASAFYGPFRTAAASAPKFGDRRTYQMDPRNAKE
AVKEVMLDLAEGADIVMVKPALAYLDVIRLVKETFPWAPVAAYSVSGEYSMIKAAARAGY
LDERLIALETLYAIRRAGADLILTYYARDVALWLKEGTPF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaaatttggcgtatcctagcgtgaggcccagaaggttgcgcgccaacaagctt
ataagagatgccgtggcggagacctctctatctcccgacgatctaataatgcccatattt
gtcaaagagggttcctccatcgagcacatagagtccatgccgggctacttcagatggcct
gtgggctccgagctagtgaaacacgttgaggaggcgctcaatttaggtgtgaataagttc
atactcttcggagttctgccggatgacatcaaagaccccgagggcagagccggttacgac
ccggagggagtagtgcctaaggcgctgaggttattgaaagagactttcggcgacagagta
ttgctcttcgccgatgtgtgtctgtgcgagtatacagaccacggccactgcggaatcgtc
gtctacgataagaagggttggaaaatagacaacgataagactatctcaatatatgcaaag
gaggctgtcacttatgcagaggccggtgccgactttgtagcgccaagcgggatgatggac
ggccaggtcagagcgatcagacaaacgctggattcggcgggctatactgacgttggcata
atggcatactcagctaaatacgcctctgcgttttatgggccgttcagaacggccgccgcg
tcggctcctaagttcggcgacagaaggacttatcagatggacccgagaaacgctaaggag
gccgtaaaggaggtcatgttggatctcgccgagggggctgacatagtcatggtgaaaccc
gcattagcatatctcgacgtcataaggctagtgaaagagaccttcccgtgggcgcctgtg
gcggcgtatagcgtctcgggcgagtactctatgataaaggctgctgcgcgggcgggctat
ctcgacgaaaggcttatcgctttggagactctctatgcgataaggcgggctggcgccgac
ttgatacttacatactacgctagggatgtagccctttggctcaaagagggcacaccgttt
tga

DBGET integrated database retrieval system