KEGG   Thermoproteus tenax: TTX_1597Help
Entry
TTX_1597          CDS       T01641                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ttn  Thermoproteus tenax
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TTX_1597
Enzymes [BR:ttn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TTX_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402389..1403039
Genome map
AA seq 216 aa AA seqDB search
MGDVDLLQGAPAENLARIERALRALDPPWIMVGGEHTATLAALRALRPKTYIHIDAHMDS
RDAWPPGQKLSHATFVRRAAEELGIYTIYIAVRAYDDEEAVFAKKAGFLVVDGNRKVTRA
QLLDALATATRPAYVSLDLDVMDPSDFPAVGTPEAGGLTFRELEGIYLDVLLESKPAAVD
IMEFSPPNDVADIGAVKLARLLLTATKILAELSRRR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgggggacgtcgatcttctacagggagcgcccgcagagaatttggcgcgcattgagagg
gctctgagggctctggatcctccgtggataatggttggcggcgagcatacagccacattg
gctgcgctcagagcgctgaggcccaagacctatatccacatagatgcccatatggacagc
agagatgcttggccgccgggccagaagctctcccacgctacattcgtccggcgggcggcc
gaggagctgggcatttatacaatatatatagccgtgagggcctacgacgatgaggaggcc
gttttcgcgaaaaaggccggcttcctagtcgtagatggcaatagaaaggtcactagggcc
cagctgttggacgctctggccacggccacgaggcctgcttatgtctctttggacctagac
gtcatggatccctccgattttcccgcggtgggaacgccggaggcgggcgggctcaccttc
agggagctggagggtatatatctcgacgtattgctcgagtctaagccggccgctgtcgac
ataatggagttctcgccccccaacgacgtggctgacattggagccgtgaagctggcgaga
ctgttgctgacggctacgaagatactggccgaattgtcgcgcagacgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system