KEGG   Thermoproteus tenax: TTX_1760Help
Entry
TTX_1760          CDS       T01641                                 

Gene name
acs-2
Definition
(RefSeq) acetyl-CoA synthetase 2 (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttn  Thermoproteus tenax
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTX_1760 (acs-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_1760 (acs-2)
   00620 Pyruvate metabolism
    TTX_1760 (acs-2)
   00640 Propanoate metabolism
    TTX_1760 (acs-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_1760 (acs-2)
   00680 Methane metabolism
    TTX_1760 (acs-2)
Enzymes [BR:ttn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TTX_1760 (acs-2)
Lipid biosynthesis proteins [BR:ttn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TTX_1760 (acs-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1536884..1538890)
Genome map
AA seq 668 aa AA seqDB search
MKGMSLESENLPFNEYVYNDRWRSRTLDVKSYWDLHRRSIESFEEFWASIARELEWFKPW
DKVLDASNPPFYKWFVGGELNLSYLALDRHVKTWRKNKLALIWEGEPVDQSGYPVDRRKL
TYYDMWREVNRVAYMLRNNFGVRKGDRITIYLPMIPELPIVMYAAWRIGAITSVVFSGFS
ADALADRINDSQSRLVITADGFWRRGKVVRLKDIVDKALEKAPGVENVVVYRRLGLNDVP
MTEGRDWFWEKALAGVPHNAYVEPERLESTHPSYILYTSGTTGKPKGIIHDTGGWAVHVY
ATMKWVFDVRDDDIYWCTADIGWVTGHSYIVLGPMLMGATQIMYEGAPDFPQPDRWWAII
ERYGVSILYTSPTAIRTFMRFGEEWPRKHDLSTLRIIHSVGEPINPEAWRWAYTNLGSQN
VAFGSTWWMTETGGIVISHAPGLYLAPMKPGTNGPPLPGFEVDVVDESGKPAPPGVRGYL
VIKRPWPGMLHGIWGDPERYIKTYWSRFPGMFYAGDYAIRDQDGYIWVLGRADEVIKVAG
HRLGTYELESAFISHPAVAEAAVIGVPDPIKGEVPIAFIVLKQGVAGTDELRKELRQHIR
NTVGPIAEPAQIFFVSKLPKTRSGKIMRRLLRAVATNSPLGDTTTLEDETSVEEAKRAYE
ELKREVSQ
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtatgtctctagaaagtgagaatctgccattcaatgaatatgtatacaatgat
agatggagatcgcgaactttagatgtaaagtcctactgggacctccacagacggagcatc
gagagcttcgaggagttctgggcctcgatagctagggagctcgagtggttcaagccctgg
gacaaagtgttggacgcgtccaacccgcccttctacaaatggttcgttggaggggagctg
aatctgtcctacctggctctggacagacacgtcaaaacttggcgcaagaacaagctcgcc
ctcatatgggagggggagcccgtggaccagagcggctacccggtggacaggaggaagctc
acgtactacgacatgtggagggaggtgaacagagtggcctatatgttgaggaacaacttt
ggcgtcaggaagggcgatcgcatcacgatatatttgccgatgatacctgagctcccgatc
gtcatgtacgcggcctggagaataggggctataaccagcgtggtgttctccgggttctcc
gcagatgccttggccgaccgcataaacgactcccagtctcggttagtaataacagcggac
ggcttctggaggaggggcaaggtggtgaggctgaaggatattgtggacaaggcgctggag
aaggcgccgggggtcgagaacgtcgtcgtctatagaaggttgggcctaaacgacgtgcct
atgactgagggcagagactggttctgggagaaggccttggccggcgtacctcacaacgca
tatgtggagcccgagaggctcgagagcacgcatccatcctatatactatatacatcgggc
accaccgggaagcccaagggcataatacacgatacaggcggttgggccgtccatgtgtac
gccactatgaagtgggtcttcgacgtaagagacgatgacatctactggtgcacggccgac
ataggttgggtcactggacactcctacatagtattgggcccgatgttaatgggcgccaca
caaatcatgtacgagggcgcgcccgacttcccgcagcccgaccgctggtgggcgatcata
gagagatacggcgtgagtatattgtacacttcgcccactgcgataaggaccttcatgagg
ttcggcgaggagtggcccaggaagcacgatctgtcaacgttgaggatcattcactcggtc
ggtgagcccataaaccccgaggcttggaggtgggcctatactaatttaggcagccagaac
gtggccttcggctccacttggtggatgacagagaccggcggcattgtgatatcccatgcg
ccgggcttatacttagcgcccatgaagcctggaacgaacggcccgccgctacctggcttt
gaggtcgacgtcgtcgacgagagcggcaagccggcgccgccgggcgtcagaggctacctc
gtgatcaagaggccgtggccgggcatgctccacggcatatggggcgacccggagcgctac
atcaagacgtactggtcgaggttccccggcatgttctacgccggcgactacgccataagg
gaccaggacggctacatatgggtgttgggcagagccgacgaggtgataaaggtcgcgggc
caccgcctcggcacctacgagctggagtcggcgtttatatcccacccggccgtcgccgag
gccgcagtgataggggtgcccgacccgataaagggcgaggtgcccatagcgttcatcgtt
ctaaaacaaggcgtggctggaactgacgagctcagaaaggagctacgccagcacataagg
aacaccgtgggaccaatagcggagcctgcgcagatattcttcgtgtcgaagctccccaag
acgcgctcgggcaagataatgcgccgtctgctgagagcggtggccacgaactcgccgttg
ggagacactacaacattggaggacgagacctcagtggaggaggccaagagggcgtacgaa
gagctaaaaagagaagtatctcaataa

DBGET integrated database retrieval system