KEGG   Thermoproteus tenax: TTX_1762Help
Entry
TTX_1762          CDS       T01641                                 

Definition
(GenBank) archaeal fructose 1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00010  Glycolysis / Gluconeogenesis
ttn00030  Pentose phosphate pathway
ttn00051  Fructose and mannose metabolism
ttn00680  Methane metabolism
ttn01100  Metabolic pathways
ttn01110  Biosynthesis of secondary metabolites
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
ttn01200  Carbon metabolism
ttn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_1762
   00030 Pentose phosphate pathway
    TTX_1762
   00051 Fructose and mannose metabolism
    TTX_1762
  Energy metabolism
   00680 Methane metabolism
    TTX_1762
Enzymes [BR:ttn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TTX_1762
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TTX_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: CCC82382
UniProt: G4RLD7
Position
complement(1539115..1540317)
Genome map
AA seq 400 aa AA seqDB search
MKTTISIIKADIGGWPGHAWVHPKMLELAAERLREAQRRGLIIDYFVYNVGDDISLLMTH
TKGENHPEIHGLAWETFKEVTEKIAKKFKLYGAGQDLLKDTFSGNIRGMGPQVAEMEIEE
RPSEPVITFAADKTEPGAFNLPMYKMFADPFNTAGLVIDPAMHEGFLYEVLDVYEHKVYL
LKAPEDIYSLLGLIGTTGRYIVRRVYRRSDGAPAAAVSVERLNLIAGKYVGKDDPVAIVR
AQHGMPAVGEVLEAFAYPHLVHGWMRGSHAGPLMPMKFYSIDAEKRIAVGARMTRFDGPP
KIGALGWQLHDGYLEGPVDLFDDPAFDYTRQLAAMITDYIRRMGPFQPHRLPPEEMEYTS
LPKILAKIQSFSADDYEKNRQAYIKRALASAGLVEAQSHD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccactataagcataatcaaggcagatatagggggttggccaggccacgcttgg
gtccaccccaagatgttggagctagccgccgagagactaagggaggctcagaggaggggc
ctcataatagattatttcgtttacaacgtgggggacgacatctcgctcctgatgacgcat
acaaagggcgagaaccaccctgagatacacggcctcgcttgggagaccttcaaggaggtc
acagagaagattgcaaagaagttcaagctctacggcgcaggccaagacctcttgaaggac
accttctcggggaacataaggggcatggggccccaggtcgccgagatggagatagaggag
aggccctcggagcctgtcataactttcgcggccgataagaccgagcctggcgcgttcaac
ttgcctatgtataagatgttcgccgatccgttcaatacagccggccttgtgatagacccc
gcgatgcacgagggcttcctctatgaggtattggacgtgtacgagcacaaagtatacctc
ttgaaagcgcccgaggatatatactcgctcctcggccttataggcacgacgggcagatat
atagtcaggagggtatatcgtagatctgacggcgctcctgcggccgccgttagcgtcgag
aggctcaacttgatcgccgggaagtacgtggggaaggacgaccccgtcgccatagtgagg
gctcaacacggcatgccggctgtcggcgaggtgttggaggccttcgcttatccccactta
gttcacggttggatgaggggaagccatgcgggccccctcatgcccatgaagttttactcc
attgatgcagagaagaggatcgcggtcggcgccaggatgaccaggttcgacggcccgccc
aagataggcgcgctcggctggcaactacacgatggatacttggagggcccagtggaccta
ttcgacgacccagccttcgactacacgcgccagttggccgccatgataacggactatatc
agaaggatgggacccttccagccgcaccgccttccgccggaagagatggagtatacatcg
ttgccgaagatcttggcaaaaatacaatcgttcagcgccgatgactacgagaagaatagg
caagcctatataaagagagctctggcttcagctgggcttgtcgaagcgcagtcacacgac
tag

DBGET integrated database retrieval system