KEGG   Thermoproteus tenax: TTX_1762Help
Entry
TTX_1762          CDS       T01641                                 

Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ttn  Thermoproteus tenax
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTX_1762
   01230 Biosynthesis of amino acids
    TTX_1762
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_1762
   00030 Pentose phosphate pathway
    TTX_1762
   00051 Fructose and mannose metabolism
    TTX_1762
  Energy metabolism
   00680 Methane metabolism
    TTX_1762
Enzymes [BR:ttn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TTX_1762
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TTX_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1539115..1540317)
Genome map
AA seq 400 aa AA seqDB search
MKTTISIIKADIGGWPGHAWVHPKMLELAAERLREAQRRGLIIDYFVYNVGDDISLLMTH
TKGENHPEIHGLAWETFKEVTEKIAKKFKLYGAGQDLLKDTFSGNIRGMGPQVAEMEIEE
RPSEPVITFAADKTEPGAFNLPMYKMFADPFNTAGLVIDPAMHEGFLYEVLDVYEHKVYL
LKAPEDIYSLLGLIGTTGRYIVRRVYRRSDGAPAAAVSVERLNLIAGKYVGKDDPVAIVR
AQHGMPAVGEVLEAFAYPHLVHGWMRGSHAGPLMPMKFYSIDAEKRIAVGARMTRFDGPP
KIGALGWQLHDGYLEGPVDLFDDPAFDYTRQLAAMITDYIRRMGPFQPHRLPPEEMEYTS
LPKILAKIQSFSADDYEKNRQAYIKRALASAGLVEAQSHD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccactataagcataatcaaggcagatatagggggttggccaggccacgcttgg
gtccaccccaagatgttggagctagccgccgagagactaagggaggctcagaggaggggc
ctcataatagattatttcgtttacaacgtgggggacgacatctcgctcctgatgacgcat
acaaagggcgagaaccaccctgagatacacggcctcgcttgggagaccttcaaggaggtc
acagagaagattgcaaagaagttcaagctctacggcgcaggccaagacctcttgaaggac
accttctcggggaacataaggggcatggggccccaggtcgccgagatggagatagaggag
aggccctcggagcctgtcataactttcgcggccgataagaccgagcctggcgcgttcaac
ttgcctatgtataagatgttcgccgatccgttcaatacagccggccttgtgatagacccc
gcgatgcacgagggcttcctctatgaggtattggacgtgtacgagcacaaagtatacctc
ttgaaagcgcccgaggatatatactcgctcctcggccttataggcacgacgggcagatat
atagtcaggagggtatatcgtagatctgacggcgctcctgcggccgccgttagcgtcgag
aggctcaacttgatcgccgggaagtacgtggggaaggacgaccccgtcgccatagtgagg
gctcaacacggcatgccggctgtcggcgaggtgttggaggccttcgcttatccccactta
gttcacggttggatgaggggaagccatgcgggccccctcatgcccatgaagttttactcc
attgatgcagagaagaggatcgcggtcggcgccaggatgaccaggttcgacggcccgccc
aagataggcgcgctcggctggcaactacacgatggatacttggagggcccagtggaccta
ttcgacgacccagccttcgactacacgcgccagttggccgccatgataacggactatatc
agaaggatgggacccttccagccgcaccgccttccgccggaagagatggagtatacatcg
ttgccgaagatcttggcaaaaatacaatcgttcagcgccgatgactacgagaagaatagg
caagcctatataaagagagctctggcttcagctgggcttgtcgaagcgcagtcacacgac
tag

DBGET integrated database retrieval system