KEGG   Thermoproteus tenax: TTX_1786Help
Entry
TTX_1786          CDS       T01641                                 

Gene name
oorB
Definition
2-oxoacid ferredoxin oxidoreductase subunit beta (EC:1.2.7.-)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
ttn  Thermoproteus tenax
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTX_1786 (oorB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_1786 (oorB)
   00020 Citrate cycle (TCA cycle)
    TTX_1786 (oorB)
   00620 Pyruvate metabolism
    TTX_1786 (oorB)
   00640 Propanoate metabolism
    TTX_1786 (oorB)
   00650 Butanoate metabolism
    TTX_1786 (oorB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_1786 (oorB)
   00680 Methane metabolism
    TTX_1786 (oorB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TTX_1786 (oorB)
Enzymes [BR:ttn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TTX_1786 (oorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1559680..1560603
Genome map
AA seq 307 aa AA seqDB search
MTVRIDQLPKKRYVLPGNAACAGCGMMIGWKILGMALGEEAVLSIPASCAAVVQGLAPKS
GVAMPILNVPFASAASVATGIAHAFSQLGVRGQSVVWAGDGGTADIGFAALSAAAERNSN
ILYIMYDNEAYMNTGIQRSSETPKGAWTTTTPAGKRESKKDVALILMAHDVPYVATASIA
YPQDFYRKIKRASEIKGFKFIHLFAPCPPGWLFDPSLTVEVARKAVETGFFILWEYDHGE
LKLNPPSSALVDKKRRRPLTEYLKLQGRFANLTEEQIAELEREVDRRWEFLLRFMEAKRR
VDGAAGI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcagaatagaccagctcccgaagaagaggtacgtccttccgggcaacgctgcg
tgcgcaggctgcggcatgatgatcggatggaagatactggggatggcgctgggggaggag
gccgtgttgtctataccggccagctgtgccgcagtggtacagggcctggcccccaagtcg
ggcgtggcaatgccgatcttgaacgtgccgtttgcatcggccgcgtcagtggccaccggg
atcgcccacgcgttcagccagctgggggtgaggggccagtctgtggtctgggccggcgac
ggcggaacggcagatatagggttcgccgcccttagcgctgccgccgagaggaactccaat
atactgtatattatgtatgacaacgaggcctatatgaacaccggcattcagaggagcagc
gagacgccgaagggcgcctggactacgacgactccggcgggcaagagggagtccaagaag
gacgtagccctcatacttatggcccacgatgtcccctatgtggcgaccgccagcatcgcc
tatccgcaggacttctacaggaagatcaagagggcttcagagataaagggctttaagttc
atacatctcttcgcgccgtgtccccccggctggctcttcgacccctcgctgaccgttgag
gtcgccagaaaggccgttgagaccggcttcttcatactctgggagtacgaccacggagag
ctcaagctcaatccgccgagctcggcgcttgtcgataaaaaacgcaggaggcctctaacg
gaatatctgaagctacagggcagattcgccaacttgactgaggagcagatagctgagcta
gagcgcgaggtagaccgcagatgggagttcttgctcaggtttatggaagccaagaggaga
gtggatggggccgccgggatttga

DBGET integrated database retrieval system