KEGG   Thermoproteus tenax: TTX_2033Help
Entry
TTX_2033          CDS       T01641                                 

Gene name
oorB
Definition
(GenBank) 2-oxoacid ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00010  Glycolysis / Gluconeogenesis
ttn00020  Citrate cycle (TCA cycle)
ttn00620  Pyruvate metabolism
ttn00633  Nitrotoluene degradation
ttn00640  Propanoate metabolism
ttn00650  Butanoate metabolism
ttn00680  Methane metabolism
ttn00720  Carbon fixation pathways in prokaryotes
ttn01100  Metabolic pathways
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
ttn01200  Carbon metabolism
Module
ttn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
ttn_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_2033 (oorB)
   00020 Citrate cycle (TCA cycle)
    TTX_2033 (oorB)
   00620 Pyruvate metabolism
    TTX_2033 (oorB)
   00640 Propanoate metabolism
    TTX_2033 (oorB)
   00650 Butanoate metabolism
    TTX_2033 (oorB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_2033 (oorB)
   00680 Methane metabolism
    TTX_2033 (oorB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TTX_2033 (oorB)
Enzymes [BR:ttn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TTX_2033 (oorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: CCC82646
UniProt: G4RM51
Position
complement(1775091..1776038)
Genome map
AA seq 315 aa AA seqDB search
MRVVYRGVWDLPAEELFASGHRACAGCGPAIAMRWITKTAGANTIVVNATGCMEVTTTQY
PETAWMLPYLHVAFENAAAAASGVESAVRTLSKKGLWKSGKTNVIVVAGDGGTYDIGLQS
LSGMLERRHHVLYILYDNEAYMNTGIQRSGSTPKYAWTTTTPVGKAIRGKIQEKKDIMGI
VMAHRVPYAATASISNILDMANKIKTALEYTEEGPTFLHILAPCPPGWRFPEERTVEVAR
LAVETGYFPLYEYDHGKIKLNPPTSAIVADPKRRKPLKEFLKMQGRFAHLTDAEIEELER
AVLTNLEYLSKLASL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcgtctataggggcgtctgggatctgcccgccgaggagctctttgcgtcaggc
caccgcgcgtgcgccggttgcggcccagctatagcaatgcgttggattacaaagacggcg
ggcgccaacaccatagttgtcaacgccaccggctgcatggaggtcaccaccacgcagtat
ccagagacggcgtggatgttaccgtatctccacgtcgcgttcgagaacgccgcggccgcc
gcgtcgggagtcgagtcggccgtgaggactctcagcaagaaggggctgtggaagtccggc
aaaaccaacgtgatagtcgtagcgggcgacggaggcacctacgacatagggcttcagtct
ctcagcggcatgttggagaggagacaccatgtcctctacatactttatgacaacgaggcc
tatatgaacaccggcattcagaggagcggctctacgcctaagtacgcctggactaccact
acgccagtcggcaaggcgatcagaggcaagatccaggagaagaaggacatcatgggcata
gtcatggcccacagagtcccgtatgcagcgacagcgtccatctccaatatacttgatatg
gccaataagataaagacggccctggagtacaccgaggaagggcccacgttcctccacata
ctggctccgtgtccgcctggctggaggttccccgaggagcgcactgtggaggttgcaagg
ctagctgtggagaccggctacttccccttgtacgagtacgaccacggcaagatcaagctc
aacccaccgacctctgccattgtggctgacccgaagaggaggaagccattgaaggagttc
ctcaaaatgcagggcagattcgcgcatcttacggacgcagagatagaggagctggagaga
gctgtcttaacaaatttagagtatctctccaagctggcgtccctctag

DBGET integrated database retrieval system