KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00044Help
Entry
Thethe_00044      CDS       T02407                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tto00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thethe_00044
DNA repair and recombination proteins [BR:tto03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Thethe_00044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
40611..41210
Genome map
AA seq 199 aa AA seqDB search
MNVYSRSLSRLIDELSRLPGIGRKTAQRLAFYILDMPKDDVINLSNAILEAKNNLKYCNK
CYNFTDSDLCNICSDETRDSSTICVVSDPKDVVAMEKTREYRGLYHVLHGVISPMDGIGP
EDIKIKELLERINNNDIKEIILATNPDIEGEATAMYIAKLIKPFGIKVTRIAHGVPVGGD
LEYTDSVTLSRALEGRREM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttattcgaggtcattgtcaaggcttattgatgaattatcaagacttccaggt
attggacgaaaaacagcacaaagacttgcattttacatcttggatatgccaaaagatgac
gttattaatttatctaatgccatattggaggcaaaaaacaatttaaaatactgcaacaag
tgttataatttcactgatagcgatttatgcaatatctgtagcgatgaaaccagagattca
tctacaatttgtgtagtatctgatccgaaagatgtagtagctatggagaaaacaagggag
tatcgtggtttataccatgtgctgcatggtgtaatatcacccatggacggtataggacca
gaagatataaagataaaagaattgctagaaaggattaataataacgacataaaggagatt
atattagcgacaaatcccgatatagaaggcgaagcgactgctatgtacattgcaaaactt
ataaaaccttttggcataaaagtgacgaggatagcacatggtgtacctgttggtggtgac
ctcgaatatactgattctgttactttatcgagggcattggaaggtagaagggaaatgtaa

DBGET integrated database retrieval system