KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00189Help
Entry
Thethe_00189      CDS       T02407                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:tto00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180017..180883
Genome map
AA seq 288 aa AA seqDB search
MDKLRAKSYAKINLSLDVKGKRDDGYHIVNMVLQSIDLCDKLEFEINSDIVFECDNKYIP
SDGSNLIVKAANLLKREFGGYGALIRLNKNIPVAAGLAGGSSNAAATLVALNKLWNLNID
LSMLKQLAVSLGADVPFCIEGGTKVASGIGDVLLDIKTPQLKLLIVKPPLFVSTKDVYTE
YDKLDFIENNYTIKMIDAINSGSITNICSSLGNDLERVTIKNYPIIGEIKKMMIERGASG
TLMSGSGPTVFGIFDNWDSLNMAYNAFLNEGFFVYIANTIDKGIELYE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactaagggcaaaatcatacgctaagataaacttgtcgcttgacgtcaaaggt
aagagagatgacggataccacattgtaaacatggttttgcagtcaatagatttatgtgat
aaattagaatttgaaataaacagtgatatagtttttgaatgtgataataagtatatacca
tcagatggaagcaatcttatagtaaaggcggcaaatctattaaaaagagaatttggggga
tatggcgcattgatacggctcaataaaaatatacctgttgctgcagggcttgcaggtgga
agctctaatgcagcagcaacgttagtagcattgaataagctttggaatcttaatatagat
ttgtctatgttgaaacaattagctgtatcattgggagctgatgttcctttttgcattgaa
ggtggaactaaggtggcaagcggcatcggagatgttcttttagacataaagacaccgcag
ctaaagttgcttattgtgaaacctccgttgtttgtatcaacaaaagacgtatatactgaa
tatgacaagcttgattttatagaaaataattatacaataaaaatgattgatgctataaat
tcgggcagtataacaaatatctgcagtagcctaggaaatgatttggaacgtgtaactatc
aagaattatccaattatcggcgagatcaaaaaaatgatgattgaaagaggagcttcaggc
acactgatgagtggcagcggtccaacggtatttggaatctttgataattgggattcttta
aatatggcgtataacgcatttttgaatgagggcttctttgtatatattgctaatactatt
gataaggggatagaactgtatgaataa

DBGET integrated database retrieval system