KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00358Help
Entry
Thethe_00358      CDS       T02407                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tto00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359423..360877
Genome map
AA seq 484 aa AA seqDB search
MEKRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGAKLILRIEDTDLTRSSKDFEKLIFKE
LNWLGIEWDEGPDKPGDYGPYRQSERLHIYRQYAEQLIKEGKAYRCYCTPEELDKDREES
VKRGDIPRYSGRCRHLTKEQEEEYLRQGRKPSIRFIIPDDVIIAFDDMIKGRIEIKSDTL
GGDMIIVKSDGMPTYNFAVVIDDTLMKISHVIRGEDHIYNTPKQLLIYEALGFKPPVFAH
APLILGPDRTKLSKRHGNTYIGQYREMGYLPEAMFNFLSLLSWSPEDNVELMSKDEIIKK
FNFNKIHSANPVFDIEKLNWMNQHYIQMSSVDRIVDLAIPYFKEAGYIKDVDDKTYEWLK
KVVSLFKDGLHYVAELKDKAKMFFDDDIEYDDNLKDDILCGDAMKVLKSFKEEIENMEDI
SEESVKSLLKMLQKNIAVKGKAFFMPIRFAITGQDHGPELVMIIPLLGKQKILYRIDKAM
KLIS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagagttagatttgcaccaagtcctacaggtgcgattcatattggtaatata
cgtacggctttgtttaattatctattttcaagaagcgaaggtgctaagctgatattaagg
atagaagatacggacttgactaggtcgtcaaaagattttgaaaagctcatctttaaagag
ttaaattggcttggcattgagtgggacgaagggcctgataaacctggtgattatggacca
tacagacaaagcgaaaggcttcatatttatagacaatatgcagaacaacttataaaagaa
ggtaaggcgtacagatgttactgtacacctgaagaactggataaagatagggaagagtct
gttaaaagaggcgatataccgaggtattcgggaagatgcagacatttgactaaagaacag
gaagaggaatacttaagacaaggtagaaaaccatccatcaggtttatcatacctgatgat
gttataatagcgtttgatgatatgataaaagggagaatagagattaaatcagatacactg
ggtggagatatgataatagttaaatctgatggcatgcccacttacaattttgcagttgta
attgatgatactcttatgaagatctcgcacgttataagaggggaagaccacatttacaat
acaccgaagcagctgcttatatatgaagcattaggttttaaaccgcccgtattcgcacat
gcgccactcatcttagggccagataggactaagctgtcaaagaggcatggcaatacttac
attggacagtatagagagatgggttatcttcctgaggccatgtttaactttttatcgctt
ttaagctggtcgcctgaggataatgtcgagttgatgtcaaaagatgaaataatcaaaaag
tttaatttcaataaaattcacagtgcaaatcctgtgtttgacattgaaaagttaaactgg
atgaatcagcattatattcaaatgagttctgtagatagaatagtagacctagcaatacca
tattttaaagaagcaggttatatcaaagatgttgatgataagacttatgaatggttaaaa
aaggtagtgtctctttttaaagacggtctacattatgttgcagaattaaaagacaaagcg
aaaatgttttttgatgatgatattgaatatgacgataatctaaaagacgatatattatgt
ggcgatgcaatgaaagttttgaagagcttcaaagaagagatcgaaaatatggaagatatc
agtgaagagtctgttaaatcattgcttaagatgttgcagaagaacatagcggttaaaggc
aaagcatttttcatgcctataagatttgctataacaggacaggatcatggaccagaactt
gtaatgataattcctcttctaggtaaacaaaagatattatacaggattgataaagcgatg
aaattaatatcgtaa

DBGET integrated database retrieval system