KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00557Help
Entry
Thethe_00557      CDS       T02407                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00340  Histidine metabolism
tto01100  Metabolic pathways
tto01110  Biosynthesis of secondary metabolites
tto01230  Biosynthesis of amino acids
Module
tto_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Thethe_00557
Enzymes [BR:tto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Thethe_00557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGB18250
UniProt: L0IFC8
Position
546180..547466
Genome map
AA seq 428 aa AA seqDB search
MIKIYDFSNSIDNTVIRNLTNRSKLENKDVEATVSEIIYNVKMHGDRALFDYTLKYDGVE
IDDKNIMVEKKEIDDAYSKVDKEFISALRNALKNITEYHENQKQKTWLDFKGGIVYGQKI
RPLEKVGIYVPGGTASYPSSVLMNSIPAKVAGVDEIVMVTPVKAGLNPFVIVAANEVGIN
KIYKIGGAQAIAALAFGTESIPKVDKIVGPGNIFVAMAKRAVYGYVDIDMVAGPSEVLIV
ADESGNPTYLAADLLSQAEHDAMASAVLITTSKSIAEKVAEEVSRQTLYLERKDIINKSL
EDYGAIIIVNNLEDALNIANEIAPEHLELAVDNPFEMIGMVKNAGAIFLGENSPEPLGDY
IAGPNHVLPTSGTSRFFSPLSVDDFIKKMSILYYDENSLKNVSDDIVRLAEAEGLTAHAN
SIKVRFKR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatctacgattttagcaattcgattgataatacagtcattagaaatttgacc
aatagatcaaagcttgagaataaagatgtagaggcgactgtgtctgaaataatttataat
gtcaagatgcatggagacagagctttatttgattatacattaaaatacgatggtgtagaa
atagatgataaaaacataatggttgaaaaaaaagagatagatgatgcttacagcaaagta
gataaggaatttataagtgctttaaggaatgcccttaaaaatattacagaatatcacgaa
aatcagaagcaaaaaacatggttagattttaaaggcggtatagtatacggccaaaagata
aggcctttagaaaaagtaggcatatatgtgcctggtggtactgcttcgtatccttcgtct
gttttgatgaatagcattcctgcaaaagtggcaggtgttgatgagatagtaatggttacg
ccagtgaaagctggattaaatccatttgtgattgtggcagctaatgaagttggaatcaac
aagatctacaaaataggtggtgcacaggcaattgcagcattagcatttggtaccgaatca
atacctaaagtagataaaatagttggaccgggaaatatatttgttgccatggctaaaaga
gctgtgtatgggtatgtagatatcgatatggtggctggacccagcgaggttcttatcgtg
gcggatgaaagcggaaatccgacgtatttagcagcggatctattgtcgcaagccgaacat
gatgctatggcgtctgctgttctcattactacttctaagagtatagcagaaaaagtagca
gaagaggtaagtagacagactttataccttgaaagaaaagatataatcaataaatcgcta
gaagattatggagcaataatcatagttaataatttggaagatgctttaaatattgcaaat
gagatagcacctgagcaccttgaacttgctgtagataatccatttgagatgattggaatg
gtgaaaaacgcaggagctatctttctaggagagaattcgccggagcctcttggagattat
attgcaggtcccaatcatgtgctgcctacaagcgggacatcaagatttttctcacctctg
tctgtggatgatttcataaagaagatgagtattttatattatgatgaaaattcgctaaag
aatgtatcagatgatattgtaagattggcggaagcagaaggacttacagcacatgccaac
tctataaaagtgaggtttaaaagatga

DBGET integrated database retrieval system