KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00557Help
Entry
Thethe_00557      CDS       T02407                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tto01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tto00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546180..547466
Genome map
AA seq 428 aa AA seqDB search
MIKIYDFSNSIDNTVIRNLTNRSKLENKDVEATVSEIIYNVKMHGDRALFDYTLKYDGVE
IDDKNIMVEKKEIDDAYSKVDKEFISALRNALKNITEYHENQKQKTWLDFKGGIVYGQKI
RPLEKVGIYVPGGTASYPSSVLMNSIPAKVAGVDEIVMVTPVKAGLNPFVIVAANEVGIN
KIYKIGGAQAIAALAFGTESIPKVDKIVGPGNIFVAMAKRAVYGYVDIDMVAGPSEVLIV
ADESGNPTYLAADLLSQAEHDAMASAVLITTSKSIAEKVAEEVSRQTLYLERKDIINKSL
EDYGAIIIVNNLEDALNIANEIAPEHLELAVDNPFEMIGMVKNAGAIFLGENSPEPLGDY
IAGPNHVLPTSGTSRFFSPLSVDDFIKKMSILYYDENSLKNVSDDIVRLAEAEGLTAHAN
SIKVRFKR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatctacgattttagcaattcgattgataatacagtcattagaaatttgacc
aatagatcaaagcttgagaataaagatgtagaggcgactgtgtctgaaataatttataat
gtcaagatgcatggagacagagctttatttgattatacattaaaatacgatggtgtagaa
atagatgataaaaacataatggttgaaaaaaaagagatagatgatgcttacagcaaagta
gataaggaatttataagtgctttaaggaatgcccttaaaaatattacagaatatcacgaa
aatcagaagcaaaaaacatggttagattttaaaggcggtatagtatacggccaaaagata
aggcctttagaaaaagtaggcatatatgtgcctggtggtactgcttcgtatccttcgtct
gttttgatgaatagcattcctgcaaaagtggcaggtgttgatgagatagtaatggttacg
ccagtgaaagctggattaaatccatttgtgattgtggcagctaatgaagttggaatcaac
aagatctacaaaataggtggtgcacaggcaattgcagcattagcatttggtaccgaatca
atacctaaagtagataaaatagttggaccgggaaatatatttgttgccatggctaaaaga
gctgtgtatgggtatgtagatatcgatatggtggctggacccagcgaggttcttatcgtg
gcggatgaaagcggaaatccgacgtatttagcagcggatctattgtcgcaagccgaacat
gatgctatggcgtctgctgttctcattactacttctaagagtatagcagaaaaagtagca
gaagaggtaagtagacagactttataccttgaaagaaaagatataatcaataaatcgcta
gaagattatggagcaataatcatagttaataatttggaagatgctttaaatattgcaaat
gagatagcacctgagcaccttgaacttgctgtagataatccatttgagatgattggaatg
gtgaaaaacgcaggagctatctttctaggagagaattcgccggagcctcttggagattat
attgcaggtcccaatcatgtgctgcctacaagcgggacatcaagatttttctcacctctg
tctgtggatgatttcataaagaagatgagtattttatattatgatgaaaattcgctaaag
aatgtatcagatgatattgtaagattggcggaagcagaaggacttacagcacatgccaac
tctataaaagtgaggtttaaaagatga

DBGET integrated database retrieval system