KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00638Help
Entry
Thethe_00638      CDS       T02407                                 

Definition
ROK family protein, putative glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tto01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tto00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tto00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tto00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tto00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:tto00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
633184..634119
Genome map
AA seq 311 aa AA seqDB search
MRIGVDVGGTNIAVGLVDENGKIIATGSRPAEPKRGYAAIAKDIAEISLELIKRCGLDIS
DVESMGIGVPGVADNEKGIVLRAVNLYWTKVPLVKEIHKYIDIPINMDNDANVAALAEGI
FGAGKGTNSSVTITLGTGVGSGFILNGKVFNGAHHFAPELGHIVLGDNGVMCNCGKIGCF
ETYASATALIREGKKVAMKDSNSLILKLAGGEIESITAKNVIDAAKQFDEAAMMIFNDYV
KYLAMGIVNIINILDPEVIIIGGGVANAGDFLLKPLKEEVSKNILFKDLPYADIKKAELG
NDAGIIGASIL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcgttgatgttggtggaacaaacatagccgtaggacttgtggatgaaaat
ggtaagataatagcaacgggttcaagacctgctgaacctaaaagaggctatgctgcaatc
gcaaaagacattgcagaaatttcattggaattaataaaaagatgtggtcttgatatttca
gatgtagagtctatggggattggtgttcctggtgtagcagacaatgagaaaggaatagtt
ttaagagccgtaaatctttattggacaaaagtgccgttggtaaaggaaatacataaatac
atcgatatacctataaatatggacaacgatgcaaatgttgctgcactggcagaaggaata
tttggagcaggaaaaggaacaaattcatctgttactataactcttggcactggtgtcggc
tcaggattcatattaaatggaaaagtgtttaatggcgctcaccattttgcgccagagctt
ggacatatcgttttaggagacaatggcgttatgtgcaattgtggcaaaattggctgtttt
gagacgtatgcatctgcaacggctctcatcagagaaggcaagaaggttgcaatgaaggac
agcaattcgcttatcttgaaactggcaggcggtgagatagagtctattacagctaaaaat
gtcattgatgcagcaaaacagtttgatgaagcagctatgatgattttcaatgattatgtg
aagtatcttgcaatgggaattgtgaacattataaatatacttgatccagaagttataata
atcggtggcggtgtagctaatgctggagattttcttttaaagccgcttaaagaagaagta
agtaaaaatatactattcaaggatctgccatatgcagatattaaaaaggcagagcttgga
aatgacgcagggataattggagcgtcaattttatga

DBGET integrated database retrieval system