KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00938Help
Entry
Thethe_00938      CDS       T02407                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Brite
Enzymes [BR:tto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Thethe_00938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935450..936466
Genome map
AA seq 338 aa AA seqDB search
MLSKLENDNISLKEVYKDYFPIGAAIAVSDLEDEGQREILLKHFNSITPENSLKFAIIHP
EEDEYAFDDGDKIVNFAAENRMMVRGHTFVWHNQVPEWLFKDESGEAVSKEILVERLRAH
INTLCRRYNDKIYAWDVVNEAVEDKSDFLYRDSQWYKIIGEEYLDLSFKIARQASQNAVL
FYNDYNNEKPEKLHKSYKLLKSMIDRGVPIDGIGIQGHWDIHDRDLFDNLKAAIELYASL
GVKIQITELDVSMFSFDDKTRSILKPTDEMIEQQSKVYKKLFEIFRYYKDVISGVTFWGI
SDKHTWKDNFPVKVRKDWPLLFDVDGRPKSAFYSIVDF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcaaagttagaaaatgataatataagtttaaaagaagtgtataaggattatttt
cccataggagctgctatagcggtaagtgatttggaagatgaagggcagagggaaattctt
ttaaaacattttaacagcataacgcctgaaaactcgcttaaatttgcaatcatacaccca
gaagaagatgaatatgcgtttgatgatggggataaaattgtcaattttgctgcagaaaat
agaatgatggtgagggggcatacatttgtatggcacaatcaagttcctgaatggcttttt
aaagatgaatcaggtgaagcagtttcaaaggaaatcttagtagaaaggcttagagcgcac
atcaatacattgtgtagaaggtacaatgacaagatatacgcatgggatgtcgtaaatgag
gctgtggaggataagagcgactttttatatagggactcccagtggtataagataatcggc
gaagaatatttggacttgtcttttaagattgcaagacaagcatcacaaaatgcggttctt
ttttacaacgattataacaatgagaagcctgaaaaactacataaatcgtataagctatta
aaatcaatgattgacaggggagttccaattgacgggattgggatacagggccattgggat
atacatgacagagacctttttgacaatctgaaagctgccatagaattgtatgcttcttta
ggagtaaaaattcagataacagaacttgatgtttcgatgttttcatttgatgataagaca
agaagtattttgaagccaacagatgaaatgattgaacaacaatcaaaagtttataaaaaa
ttatttgaaatattcaggtattataaagatgtgattagtggtgttactttttggggtata
agcgataaacacacatggaaagacaattttccggttaaagttagaaaagattggccgctt
ctttttgatgtcgatggtagacctaaaagtgccttttacagcatagttgatttttaa

DBGET integrated database retrieval system