KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00968Help
Entry
Thethe_00968      CDS       T02407                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thethe_00968
   00030 Pentose phosphate pathway
    Thethe_00968
   00051 Fructose and mannose metabolism
    Thethe_00968
   00052 Galactose metabolism
    Thethe_00968
   00500 Starch and sucrose metabolism
    Thethe_00968
   00520 Amino sugar and nucleotide sugar metabolism
    Thethe_00968
  Nucleotide metabolism
   00230 Purine metabolism
    Thethe_00968
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thethe_00968
Enzymes [BR:tto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Thethe_00968
    5.4.2.8  phosphomannomutase
     Thethe_00968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
973199..974569
Genome map
AA seq 456 aa AA seqDB search
MALNQNMFRMYDIRGVWNDDLTEETAELIGKAFGTYIQNEKGIKDVIVGRDNRISSKPIR
NAVINGLVSTGCNVLDIGVLSTPAFYYSRILFNYDAGLMITASHNPPQFNGFKVAFGPST
IYGDELKKLYHIAEKGDFKTGTGSLKYAYPIQSYIKMIQDKVKLGNRKLKVVVDCGNGTC
SNIYPDIIYGLGCEVYPLYCESDPTFPNHFPDPVNADNLKDLIKEVKRLGADVGIAFDGD
GDRIGVVDEKGNIIWGDMLMVLYWREIMKKHPGADAIVEVKCSKALPEEIKKLGGNPIFY
KTGHSLIKAKMKEINAVFTGEMSGHMFFADEYYGYDDAAYAAARLLRILSNTDKTLSELL
SDVPKYPSTPELRLHCDDEKKFDVVKGVTEYFREKGYDLIDIDGARVMFDGGWGLVRASN
TGPELIVRCEADTEERLKEIKDELAEVLKKYGVELK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcactaaatcaaaatatgtttaggatgtatgatataagaggtgtatggaatgatgac
cttaccgaagaaacagcagagcttattggtaaggccttcggtacatatattcaaaatgaa
aaaggtataaaagatgtgattgtaggtagggacaacaggatatcttcaaaacctataaga
aatgcggtaatcaatggacttgtctctactggctgcaatgtgctagatataggtgttcta
tcgacgcctgctttttattattcccgtatactatttaattacgatgcagggcttatgata
acagcaagccacaatccaccgcagtttaacggatttaaagttgcatttggaccatctact
atatatggtgatgagcttaagaagctatatcatattgcagagaaaggcgattttaagaca
gggacaggttctttgaaatacgcatatcccatacaaagctatataaaaatgatacaggat
aaggtaaagcttggcaatagaaagctgaaagttgttgtagactgcggaaacggtacatgc
tcaaatatatatcctgatattatatatgggctggggtgcgaagtatacccgctgtactgc
gaatcagatccgacatttccaaaccattttccggatccagtcaacgcagacaatctgaaa
gacctgataaaagaggtaaaaagacttggtgcagacgttggcatagcttttgacggtgat
ggagataggattggcgtcgttgatgagaagggcaacataatctggggcgatatgctgatg
gtgctttactggagggaaataatgaaaaagcatccaggtgcagatgccatagtcgaagta
aaatgttcaaaggcactgccggaagagataaagaaacttggtggaaatccaatcttttat
aagactggtcacagccttataaaagccaaaatgaaagaaatcaatgctgtctttacaggt
gagatgtctggacacatgttctttgcagacgagtattacggctatgatgatgcggcatat
gctgcagcaaggcttttaagaatactttccaatacggataagacattatcggagcttctt
tctgatgttccaaaatatccgtcaacgccggaattgagattgcactgcgatgatgaaaag
aaatttgatgttgtaaagggcgtgacagagtatttcagagaaaagggatatgatttaata
gatatcgacggtgcaagagttatgtttgacggtggatgggggcttgtcagagcttcaaat
acaggtcctgagttgattgtaaggtgcgaagctgatacagaggaaagattaaaagagatt
aaagatgaacttgcagaagtattaaagaaatacggcgttgagcttaagtaa

DBGET integrated database retrieval system