KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_00973Help
Entry
Thethe_00973      CDS       T02407                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
tto00040  Pentose and glucuronate interconversions
tto00052  Galactose metabolism
tto00500  Starch and sucrose metabolism
tto00520  Amino sugar and nucleotide sugar metabolism
tto01100  Metabolic pathways
tto01130  Biosynthesis of antibiotics
Module
tto_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thethe_00973
   00052 Galactose metabolism
    Thethe_00973
   00500 Starch and sucrose metabolism
    Thethe_00973
   00520 Amino sugar and nucleotide sugar metabolism
    Thethe_00973
Enzymes [BR:tto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thethe_00973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AGB18636
UniProt: L0IK58
Position
977627..978541
Genome map
AA seq 304 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVNSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKGKENLLNLVEDITNMVDIHYIRQKEPKGLGHAIYCAHTFV
GNEPFAVLLGDDIVDAEVPVLKQMIEQYERYNCSIIGVQEVPKSEVDKYGIVDANMIDDR
LYRVNNLVEKPKKEEAPSNMAILGRYIISPKIFDILKDLRPGAGGEIQLTDALKVLLDYE
AIYAYNFEGKRYDVGDKLGYLKATVEYALKRDDLKDDFIKYLKTLKLNGRDTLDEVAVSN
LDIK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcgataattccagcagcaggacttggaactaggtttttgcctgca
acaaaagcacagccaaaagaaatgcttccaatagttgataagccgactatacaatatata
gtagaagaagccgtaaactcgggtatagaagatatactcataataacaggaagaaacaaa
agagcgattgaggaccattttgacaaatctgtagaattagaactagaattaaagaaaaaa
ggcaaagaaaatcttttaaatcttgttgaagatataacaaatatggtggatatacattat
ataaggcaaaaagagccaaaaggacttggtcatgccatttattgtgcacatacatttgta
gggaacgagccatttgcagttcttttaggggacgatatagttgatgcagaagtacccgta
ttgaagcagatgatagaacagtatgaaagatacaactgttccataatcggcgtacaagaa
gtaccaaagagtgaagtagacaaatacggcatagtagatgccaacatgattgatgacagg
ctgtatagagtaaacaacctagtggagaagccaaaaaaagaagaagcaccatcaaacatg
gccatacttggaagatatataatatcgccaaagatatttgatatactaaaagacttaagg
cccggagcaggtggagaaatacagcttactgatgcacttaaagtgctattggactatgaa
gcaatatacgcatataattttgaaggaaagaggtatgatgtaggagataaattagggtat
cttaaagcaactgttgaatatgctttgaagagagacgacttaaaagatgattttataaaa
tatctaaaaactttaaaattaaacggccgtgatactttggatgaagttgctgtttctaat
ttggatataaaataa

DBGET integrated database retrieval system