KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01256Help
Entry
Thethe_01256      CDS       T02407                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thethe_01256
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thethe_01256
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Thethe_01256
Enzymes [BR:tto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Thethe_01256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1245066..1246160
Genome map
AA seq 364 aa AA seqDB search
MKIVVKVGTSTLTYENGQLNLEMMEKISRQISNLQNRGDKVILVTSGAIGAGMGKLNISK
RPKTLPEKQSLAAIGQGLLIELYEKFFNEYGKTTAQLLLTKDDFSIRDRYLNISYTLSNL
LKYNVVPIINENDTVTVDEIKIGDNDTLSALVASIIEADLLIILTDIDGLYNKDPREPDA
KLIDVVEEFTDKLFEIAGGTGTNFGTGGMYTKIQAAKICYNSGVKMVIANGKLDNVLNRI
ANGEKIGTVFMPAQNPISNRKVWIAFNAHLAGKLVIDDGAKQAILNKGKSLLPSGIISTT
GEYSVGDCVSIVDTDGREIARGLINYTVSEVDKIKGLKSTEIEEILGYKNYDEVIHRDNL
VVMS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagttgtaaaagtaggaacaagtacattgacatacgaaaatggacagctaaat
ttggaaatgatggaaaaaatctcaaggcaaatttctaatctacaaaatagaggcgataaa
gtaatactcgttacatcaggcgcaatcggtgctggaatgggtaaacttaatatatcgaaa
agaccaaaaacgttgccagaaaagcaatcattagcagcaattggtcagggattgcttata
gaactatatgagaaattttttaatgaatatggcaaaacgacagcacagcttttgctgaca
aaagatgatttttctataagagataggtatttgaacattagctatacattatcaaatcta
ttaaagtataatgtagttcctattataaatgaaaatgacacggttactgttgatgagata
aaaataggcgataatgatacattatcagcgctagttgcaagtattattgaggcagatctt
cttattatattgacggacatcgatgggctatataacaaggaccctagagaacctgatgca
aaattaatagatgttgtagaagaatttacagataagttgtttgaaatagcgggagggact
ggtacaaattttggcactggtggtatgtatacaaaaattcaggcggcaaaaatctgctat
aattcaggtgttaaaatggttatagctaatggtaagcttgataatgtgttaaatagaatt
gctaacggagaaaagataggcaccgtgtttatgccggctcaaaatcccattagcaatcga
aaggtatggatagcatttaatgcacatttggctggtaagctggttattgatgacggagca
aaacaagctatattaaataagggaaaaagcctattacctagcggcataatatctactact
ggtgaatattctgtaggtgattgtgtatcgatagttgatactgatggtagagagattgca
agaggtttgattaattacacagtatcagaagttgataaaataaagggattaaaatctacc
gaaattgaggaaattttaggttataaaaattatgatgaagttattcatagagataattta
gttgttatgagctag

DBGET integrated database retrieval system