KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01316Help
Entry
Thethe_01316      CDS       T02407                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thethe_01316
Enzymes [BR:tto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Thethe_01316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292799..1293665
Genome map
AA seq 288 aa AA seqDB search
MVIKDNFSNSGKFLSSINDYKESDIVIVGVPMDYTVSFKPGTRFGPQAIRTASLGLEEYS
VYLDRNLKEKKYYDFGDLILPYGNVEKSLDIIGNAAKEILEDGKKPLFLGGEHLISAPVI
KEVYKKYGDELVVLHFDAHTDLRTEFFGEENSHATVLRKASEFINNKNMYHFGIRSGIKE
EFEFSYKNTNMFLFNVVEPLKSVLEYIKSKPIYITWDIDVLDPAYAPGTGTPEPGGITSK
EAFNAIHILKDLNVVGMDLVEVSPDYDHSGITSILAAKLIRESILSFL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttggtaataaaagacaatttttcgaatagcggcaaatttttaagtagcattaatgattac
aaagagtcagatattgtaattgtaggcgtacctatggattatacagttagttttaaacct
ggtacacgttttggcccacaggcgataagaacagcatcattaggcttagaagaatacagc
gtttatctagatagaaatttaaaagaaaagaaatattatgattttggtgatttaatttta
ccttatggaaacgtcgagaaaagcctcgatataattggaaatgcagccaaagaaatactt
gaagatggaaaaaagccgttatttttgggaggagagcatttaataagtgctccagttata
aaagaagtttacaaaaagtatggtgacgaattggtagtacttcattttgatgcacatact
gatctaagaactgaattttttggtgaagaaaattctcatgcgactgttttaagaaaggct
tctgaattcatcaataataaaaatatgtatcattttggtatacgctctggaataaaagaa
gaattcgagttctcttataaaaatactaacatgtttttgtttaacgttgttgagccttta
aaaagtgtacttgagtatattaagtcaaaacctatttatattacatgggatatagatgtt
ttagatcctgcatatgctcctggaactggtacacccgaaccaggtggtataacatcaaaa
gaggcatttaatgcaatacacattttaaaagatttaaatgttgtcggtatggatttagtt
gaggtatcacctgattacgaccattcaggtattacttcaattttagcagcaaaacttatt
cgtgaatcaattttatccttcttataa

DBGET integrated database retrieval system