KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01594Help
Entry
Thethe_01594      CDS       T02407                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tto00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1551537..1553027)
Genome map
AA seq 496 aa AA seqDB search
MAGFVYLIGAGPGDIGLITLKAIEAIKKADVIVYDRLINDSILAMAKDGTELIDVGKMPD
SHKVPQWRINEIIAEKAMEGKSVVRLKGGDPFVFGRGGEEGEYLYDKGIPFEVIPGITSA
IAVLSYAGIPITHRNLSSSFHVITGHESDGKTENLDWKVIAKLNGTLVFLMGMKNIEFIV
NKLIENGMSKDIPAAVIMNGTTPHQKVVKGTLSDIAEKSRNEGMHNPAIIVIGKVVNMSE
KLDWFEKKRLFGKRVLLTRTYDLAMSTVDDLKDNGADVVICPTIKIIPEVDNVSKLIDNI
EKYDYIIFTSVNGVNVFKKTINLKKFDLRKLNGVKIAAIGSKTCEALNKIYIYPEVVPDE
YTSIALAGKLKSYAKGKSVAILTSDIGGDMLIDNLKDIAFLDKIVAYKNTPNYEIKDKLT
NEIKKGIDIAIFTSTSTFKYMSLILGDDISFLKNVKIAAIGPVTKESIERSGFKVDIMPS
VYTMEELVKDIIKSEE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctttgtttatttaataggtgcggggcctggtgatataggtcttattacatta
aaggcaattgaagcgataaaaaaggcagatgtgattgtatatgacagattgataaatgac
agcatacttgcaatggctaaagatggtactgagcttatagatgttggaaagatgcctgat
tcacataaagtgccacaatggagaataaatgagattattgctgaaaaggctatggagggc
aagtcggtggtgcgattaaaaggcggcgatccgtttgtatttggaagaggcggtgaagaa
ggggagtatctttacgataagggcataccgtttgaagtgattccgggaattacctctgct
atagctgttttgtcttatgcaggtattcctattacacacaggaatttaagttcatcattt
catgttataacaggccatgaatctgacggtaaaactgaaaatctcgattggaaagtgatt
gctaaactcaatggtactcttgtatttttgatgggtatgaagaacatcgaatttatagta
aataaactgattgaaaatggtatgtctaaagatattcctgctgctgtaataatgaatggg
actacgccgcatcaaaaggtggtaaagggcactttatcagatattgcagaaaagtcccgc
aatgaaggtatgcacaatccagcaataattgtcattggaaaagttgtaaacatgagtgaa
aagcttgactggttcgaaaagaaacgactttttggaaagagagtccttttaacaaggaca
tacgacttagctatgagtactgtggatgatttaaaagataatggggcagatgtcgtcata
tgcccaactataaagataattccggaagtagataatgtatcaaagcttattgataatatt
gaaaaatacgattatattattttcacaagtgtaaatggcgtcaacgtctttaaaaaaact
atcaatttaaagaaatttgatttaagaaaattgaatggagtaaagattgcagcgataggc
agtaagacatgtgaggctctaaataaaatatatatatatccagaggttgtgcctgatgaa
tatacttctatagctttagctggtaagcttaagagttatgcaaaagggaaaagtgtggcg
attttgacttctgacataggtggcgatatgcttatagacaatctcaaagatatcgccttt
ttagataagattgtggcgtataaaaataccccaaattatgaaataaaagataaattaacg
aatgagattaaaaagggtattgatatagcaatatttacaagcacatcaacatttaaatac
atgtctttaatattaggagatgatatatctttcttaaaaaatgtaaaaatagctgcaata
ggacctgtgacgaaagaatcaatagaaagaagtggttttaaagttgatataatgccaagc
gtatatacgatggaagaattagtcaaagatataataaaaagtgaggaataa

DBGET integrated database retrieval system