KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01781Help
Entry
Thethe_01781      CDS       T02407                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tto00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tto00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1749365..1750819)
Genome map
AA seq 484 aa AA seqDB search
MRLADVLKDIEYTIVKGNVDVDIRGICYDSRNSKDGSMFVAIKGFKSDGADYIGDAIERG
AVAVLVDGEISIDKDITLIKVQNTRKSLAKIASNYYGDPSKQLFLIGVTGTNGKTSVTYM
IKSILESQNNKVGLIGTIQNMIGDKVYSTERTTPESLDLQRYLRLMVDEGVKYVVMEVSS
HSLALNRVDECDFDIAVFTNLTQDHLDFHKTMDDYANAKAKLFRMAKTACVINIDDDYSS
FIIENSNAKVVTYGIKDYAYIMAKDIKNDIKGAKYTVQIEDIKSDIALKIPGLFSVYNSL
AAISVAFILGIPLQSVKMALKDVKIKGRFEVLDIDAPYNVVIDYAHTPDGLENLMKAFGE
YDTGRKILLFGCGGDRDKGKRPKMGEVAGKYADFVIITSDNPRSEDPMQIISEIEMGIKN
TNCPYKIIENRKEAIKYALSIAKDNDIVILAGKGHESYQVLKDRVIDFDEREIVKEILNG
DEKN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacttgcagatgtattaaaagatattgaatatacaattgtaaaaggtaacgtcgat
gtagatataaggggtatatgttacgattcaagaaattcaaaagatggttcaatgtttgta
gcaatcaaaggatttaaatctgatggcgcagattacataggtgatgctattgaaagaggg
gcagtagctgtcctggtagatggcgaaatcagcattgataaagatattacgctgataaaa
gttcaaaatactaggaagtcattagcaaagattgcctccaattattatggtgatccatca
aagcagctttttttgataggtgtaacaggtacaaatggtaagacttctgttacatacatg
ataaaatctatattagaaagccaaaacaacaaggtaggcttaataggtacaatacaaaat
atgataggcgataaagtttattcaacagagcgaacaacccccgaatctttagatttgcaa
aggtatcttagactgatggtagatgaaggtgttaagtatgtagtgatggaagtttcatca
cattcattggcattaaacagggtagatgagtgcgattttgacattgctgtttttacaaac
ttgacacaagaccatttagactttcataagacaatggacgactatgccaatgcaaaagca
aaactttttagaatggcaaaaacagcgtgtgtaatcaatattgatgatgattattcttca
tttataatagaaaactctaatgctaaagttgtaacatacggcataaaagattacgcatat
ataatggcaaaagacataaaaaatgacattaaaggtgctaaatatactgttcaaatagaa
gatataaaaagcgatatagctttaaaaattcccggtttatttagcgtgtacaattcgctg
gcggccatttctgtggcatttattcttggcataccgcttcagtctgtaaaaatggcgttg
aaagatgttaaaataaaaggtagatttgaggttcttgacatagatgcgccttacaatgta
gtgattgattatgctcatacacctgatggtttggaaaatttaatgaaagcatttggtgag
tacgatacaggaagaaagatattgctctttggttgcggtggcgatagagataaaggtaaa
agaccaaaaatgggggaagtcgctgggaaatatgcagattttgtaattataacatcagat
aatccaagatcagaggatcctatgcagataataagtgaaattgaaatgggtataaaaaat
acaaattgtccttacaagattattgaaaatagaaaagaagcaataaaatacgctctgtct
atagcaaaagataatgacattgttattctggcaggtaaagggcatgaatcgtatcaagtt
ttaaaagatagagttatagattttgatgaaagagagatagtaaaagagatattaaatgga
gatgaaaaaaattga

DBGET integrated database retrieval system