KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01906Help
Entry
Thethe_01906      CDS       T02407                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thethe_01906
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thethe_01906
   00052 Galactose metabolism
    Thethe_01906
   00500 Starch and sucrose metabolism
    Thethe_01906
   00520 Amino sugar and nucleotide sugar metabolism
    Thethe_01906
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thethe_01906
   00524 Butirosin and neomycin biosynthesis
    Thethe_01906
Enzymes [BR:tto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thethe_01906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1877600..1878487)
Genome map
AA seq 295 aa AA seqDB search
MKKVIGIDIGGTKILGGVIGSNGDLIKFKETSTDANLGRDHILKKLFGVLDDLFDADIEG
IGIGSAGRIDFNTGEVIYATDNLPGWTGINLKEIISQKYKTKTIVENDVNAAIIGENWVG
SAKNYRDILMITLGTGVGGAIILDGKLIRGSHFSAAEIGHTILYPDGKKCNCGQNGCVEQ
YISGTAIYKRYNELAGSNMVNSAKDVFDLFIKNDEISKLVLDEFVKSLSLLIFNIRNFID
PEIIILGGGVTNSKDLWWEYLKSQIKCDLNISIAGLNNFSTAYGAAKLILNEGVV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttattggtatagatattggtggtacaaaaattttaggtggtgttattggt
tctaatggagatttaattaaatttaaagagacttcaacagatgctaatttaggcagagat
cacatattgaaaaaattattcggtgtattagatgatttatttgatgctgatatagaaggg
attggcattggttcggccggtagaattgattttaatacaggcgaagttatttatgctacg
gataatttaccaggttggactggcataaatttaaaagaaattatttctcaaaaatataag
acaaaaacaatagttgaaaatgatgttaatgcggcaattattggtgaaaattgggtaggt
tctgctaaaaattatagagatattttaatgataactttagggacaggtgttgggggtgca
ataatactagatggtaaattgataagaggaagtcatttcagcgcagcggaaatcggccat
actatcctatatcctgatggcaagaagtgcaactgcgggcaaaatggttgcgttgaacaa
tatatatcgggtactgcaatatataaaagatacaatgaattagcgggttctaatatggtg
aatagtgcaaaagatgtttttgatctgtttataaagaacgatgaaatatcaaagttagtt
ttagatgaatttgtaaaatcgctctcattattaatttttaacataagaaattttattgat
cctgaaataatcatcctcggaggtggtgtaacaaattcaaaagatctgtggtgggaatat
ttaaaatcacaaataaaatgtgatttaaatatttctattgcaggacttaataacttttcg
acagcatatggcgctgcaaaattaattttaaatgagggggttgtctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system