KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01929Help
Entry
Thethe_01929      CDS       T02407                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thethe_01929
Enzymes [BR:tto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Thethe_01929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1899658..1901124)
Genome map
AA seq 488 aa AA seqDB search
MALNNKVQLITYPDSLGGDLKTLNDVLEKYFSDVFGGIHILPPFPSSGDRGFAPITYSEI
EPKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKD
GKPVKGDIEKMFLRRTLPYSTFKIEETGEEEKVWTTFGKTDPSEQIDLDVNSHLVKEFLL
EVFRTFSNFGVNIVRLDAVGYVIKKIGTSCFFVEPEIYEFLDWAKGQAASYGIELLLEVH
SQFEIQYKLAERGFWIYDFILPFTVLYTLINKSNEMLYDYLKNRPINQFTMLDCHDGIPV
KPDLDGLIDTKKARDVVDICVQRGANLSLIYGDKYKSEDGFDVHQIGCTYYSALNCDDDA
YLAARAIQFFTPGIPQVYYVGLLAGVNDFEAVKKTKEGREINRHNYGLKEIEESVQKKAV
QRLLKLIRFRNEYEAFNGEFMVQDCQKDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINEN
GEEVKYLV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttaataataaagtacaattaataacttatccagactcattgggcggtgatcta
aaaactttaaacgatgtattggaaaaatatttttctgatgtatttggcggtattcacatt
ttgcctccttttccatcatccggtgatagagggtttgcacctataacatacagtgagata
gaacctaaatttggaacatggtacgacattaagaaaatggctgaaaattttgacattctt
ttggatttaatggttaatcatgtatccagaagatctatttattttcaggatttcttaaaa
aaaggtagaaaatcagaatacgctgatatgtttattacattagataaactttggaaggat
ggaaaacctgtcaaaggcgacatagaaaaaatgtttttgagaaggactttgccatattcc
acatttaaaatagaagaaacaggagaagaagaaaaagtctggaccacctttggcaagaca
gatccatcagaacaaattgatttggacgtcaactcacatttagtgaaagaatttttatta
gaagtttttaggacatttagcaattttggtgttaatatagtacgactcgatgcagtagga
tatgtaataaaaaaaattgggacaagctgtttttttgtcgaaccggagatatatgaattt
ttagactgggcaaaaggacaagcagcttcttacggaatagaactgcttttggaggtacat
tcgcaatttgaaatacaatataaattagcagagcgtggtttttggatttatgattttatt
ttgccatttactgttctttatactttaataaataaatcaaacgaaatgttgtatgattat
ctaaaaaatcgtcccattaatcaatttacaatgttggattgtcatgacggaattcctgta
aagcctgatttagatggacttattgatactaagaaggctagagatgtagtcgatatatgt
gtacaaagaggtgcgaatctaagcctaatatacggagataaatataaatcagaagatggc
tttgatgtgcatcaaattgggtgcacttattattctgcattaaattgtgatgatgacgca
tatttggcagccagagccattcaattctttacaccaggtataccacaagtctattacgta
ggccttttagctggagtaaatgactttgaagcagtaaaaaagactaaagaagggcgagag
ataaatagacacaactatggtttaaaagaaatagaggaatcagttcaaaaaaaggcagtt
cagagattgctaaaattgatcagattcagaaatgaatacgaggcatttaatggtgaattt
atggttcaggactgtcaaaaggatgaaatcaggcttacttggaaaaaagatgataaacgt
tgcagtctgtttattgatttgaagacatataagacaactattgattatataaacgagaac
ggtgaagaagtaaagtatttagtataa

DBGET integrated database retrieval system