KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_01978Help
Entry
Thethe_01978      CDS       T02407                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thethe_01978
Enzymes [BR:tto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Thethe_01978
Peptidases [BR:tto01002]
 Cysteine Peptidases
  Family C44
   Thethe_01978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1955428..1956264
Genome map
AA seq 278 aa AA seqDB search
MCGICGFSGDMANYLGENNLREMLDIIIHRGPDDEGTYFKNNTALGMRRLSIIDLKSGHQ
PIHNEEKDIGVGMTFKDDEISTLLSGDLYALWLKDMKNDKYLNSFYHMPQWKDEVSQMLY
FDQKVWLPKDVLIKSDKMTMANSIELRVPFLDYRIVEFASSIPSSLKYRGNNEKYILKKA
FKDTLPSFVLNRKKNGFPVPLSSLLNLEFKNFAKDILLSQKSLSRGYFNKQYIENLFKKY
NSTSYKGRQIWLLLTFELWNRIFIDSSNASLDEEMSVI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatatgtggattttctggagatatggcaaattatctgggcgaaaataattta
agagaaatgttagacatcattattcatagaggacctgatgatgaaggtacttattttaaa
aataatacagctttaggcatgaggagattaagtataattgacttaaaaagcggacatcaa
ccaatccacaatgaagaaaaagatataggggtcggtatgacctttaaagatgatgaaata
tctacattattaagtggagatttatatgcattatggttaaaggacatgaaaaatgataaa
tatttgaattcattttatcatatgccacagtggaaggatgaagttagccaaatgttgtac
tttgatcaaaaggtatggctgccaaaagatgttcttataaagtcagataagatgacaatg
gcaaattcaatagaattgcgtgttccttttcttgattatagaatagttgaatttgcttca
tcaataccatcaagtctaaagtatagaggtaataatgaaaaatatatattaaagaaggca
tttaaagatactttgccaagttttgtattgaatagaaagaaaaatggattccccgttcca
ttaagctcattattaaatttagagtttaaaaattttgcaaaggatattttgctttctcag
aaatccctctctagaggttatttcaataagcaatatatcgaaaatctttttaaaaagtat
aatagcacaagctataaaggaagacaaatttggcttcttttgacttttgaattgtggaat
agaatatttatcgacagcagtaatgcttcattagatgaagaaatgtctgtaatataa

DBGET integrated database retrieval system