KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_02447Help
Entry
Thethe_02447      CDS       T02407                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Thethe_02447
  Lipid metabolism
   00561 Glycerolipid metabolism
    Thethe_02447
   00600 Sphingolipid metabolism
    Thethe_02447
Enzymes [BR:tto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Thethe_02447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2415192..2416550)
Genome map
AA seq 452 aa AA seqDB search
MRYVDDKAVDLKIAYIGGGSKEWARKLMSDLALEESLEGTVYLYDIDVESARLNEAIGNK
LNSQWKYKCVLSIEEALKDADFVVISILPGTFNEMMSDVHAPEKYGIYQSVGDTTGPGGL
FRALRTIPIYVDFANKIKEYCPNAWVINYTNPMALCVRTLYETFPDIKAFGCCHEVFSTQ
SLITKALKEMEGIECKRDDIYTNVLGINHFTWITKAHYKEIDLFPVYMKFVEKHKDDGYE
DRGDWQDSYFNSANLVKFDLFDKYGFIAAAGDRHLAEFTPKDYLKDPETVGKWKFHLTPV
SWRIKNRESLIEKSRRIAKGEEEFKAVTSGEEGVKQIKALLGLGDLITNVNIPNRGQIGN
VDFNTVVETNSLFTKDGVYPIFAGNIPDRVKLLMGPHILNQKMIFEAAVKKDKDLALQAM
LNDPIVNLTYEDGKKLFDEMMDNTREYLKDWH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgttgatgataaagcagtagatttaaagatagcatacattggcggtggttct
aaagaatgggctagaaaattaatgtctgaccttgcacttgaggagtctttggaaggaaca
gtgtatttatatgatatagatgtggaatcagccagattgaatgaggctattggaaacaag
ttaaacagccagtggaaatataaatgcgttttaagcatcgaagaagctctgaaagatgct
gactttgtagtcatatcaatacttcctggtacatttaacgaaatgatgtcagatgttcat
gcacctgagaaatatggaatatatcaatctgttggagatacaactggtccaggtggattg
tttagggctttaagaacgatacctatatatgttgattttgctaacaaaatcaaggagtat
tgtccaaatgcttgggtaattaactatacaaatccaatggcgttgtgcgtcagaacactt
tatgagactttcccagacataaaagcttttggttgctgtcatgaagttttttcaacgcag
tctcttattactaaggctcttaaggaaatggaaggaatagagtgcaaaagagatgacatc
tatacaaatgtattaggaattaatcactttacttggataacaaaggcccattataaagag
atagatttatttcctgtatatatgaagtttgtagaaaagcataaagacgatggatatgaa
gacaggggcgattggcaagacagctattttaattcagcaaatttagttaaatttgatttg
tttgataaatacggttttatagcagctgcaggtgacaggcaccttgcagaatttactcct
aaggactatttaaaagatccagagacagtgggaaagtggaaatttcacttgacacctgta
tcatggaggataaagaatagagaaagtcttatagaaaaaagtagaagaattgcgaaaggg
gaagaagaatttaaggctgttacttcaggtgaagaaggagtgaaacaaataaaagcactt
ttaggactaggcgaccttattacaaatgtaaatattcctaatagaggacagattggaaat
gtcgattttaatacagttgtagagacaaactctttgtttacgaaagacggagtataccct
atatttgctgggaatattcccgatagagtaaaactactcatgggacctcatatattgaat
caaaagatgatttttgaagcggcagtaaagaaagataaagatttggcgcttcaggctatg
ctaaatgatccaattgtcaatttaacatatgaagatggtaaaaagttgtttgatgagatg
atggataacacgagggaatatttaaaggattggcattga

DBGET integrated database retrieval system