KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_02538Help
Entry
Thethe_02538      CDS       T02407                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thethe_02538
   00051 Fructose and mannose metabolism
    Thethe_02538
Enzymes [BR:tto01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Thethe_02538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2508454..2509773)
Genome map
AA seq 439 aa AA seqDB search
MSKYFEKVSKIKYEGPKSNNPYAFKFYNPEEVIDGKTMEEHLRFSIAYWHTFTADGTDQF
GKATMQRPWNHLTDPMDIAKARVEAAFEFFDKINAPFFCFHDRDIAPEGDTLRETNKNLD
IIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGASTSCNADVFAYSAAQVKKALEITKEL
GGQNYVFWGGREGYETLLNTDMELELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEPTK
HQYDFDVANVLAFLRKYDLDKYFKVNIEANHATLAAHDFQHELRYARINGALGSIDANTG
DMLLGWDTDQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAGM
DAFAKGFKVAYKLVKDGVFDKFIEERYASYKEGIGADIVSGKADFKSLEKYALEHSEIVN
KSGRQEMLESILNQYLFAE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatattttgaaaaagtatcaaaaattaaatatgaaggacctaaatcaaataat
ccttatgcatttaaattctacaatccagaggaagtaatcgatggaaagacgatggaggaa
catcttcgcttttctatagcttactggcacacgtttacagcagatgggacagaccaattc
ggaaaagcaacaatgcaaaggccgtggaatcaccttacagatcctatggacatagcaaaa
gctagagttgaagcggcatttgaattttttgacaaaattaatgcacctttcttctgtttc
catgatagagatatagcaccagaaggtgatacattaagagagaccaataaaaacctggat
atcatcgttgctatgataaaggattacctgaagaccagcaagacaaaagtgttgtgggga
actgcaaacctattctcaaatccgagatttgtacatggtgcatcaacatcctgcaatgca
gatgtttttgcatactctgcagcacaggttaagaaagcacttgaaattacaaaagagctt
ggaggacaaaactacgtattctggggcggaagagaaggatacgagacgcttcttaataca
gatatggagttagagcttgataattttgcaagatttctacacatggcagttgattatgca
aaagaaatcggctttgaaggacaattcttaattgagccgaagccgaaagaacctacaaaa
catcaatacgactttgatgtagcaaatgtattagcattcttgagaaaatacgatcttgat
aaatatttcaaagtgaatatagaagctaatcatgcaacattagcagcacatgacttccag
catgagctcagatatgcaaggataaatggagcattaggatcaatagatgcaaatacaggt
gacatgcttttaggatgggatacagatcagttcccgacagatatacgcatgacaacactt
gcaatgtatgaagtcataaagatgggtggatttgacaaaggtggattgaatttcgatgca
aaagtaagaagagcttcatttgaaccagaagatcttttcttaggacatatagcaggtatg
gatgcttttgcaaaaggattcaaagtagcttataagcttgtaaaagatggcgtatttgac
aagttcatcgaagagagatatgcaagctacaaagaaggcattggcgcagatattgtaagc
ggtaaagctgacttcaagagtttggagaaatacgcattagagcacagcgagattgttaat
aaatcaggtaggcaagaaatgcttgaatcaatactcaatcagtatttgtttgcagaataa

DBGET integrated database retrieval system