KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_02573Help
Entry
Thethe_02573      CDS       T02407                                 

Definition
dipeptidase, putative
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tto01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tto00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2551607..2553001)
Genome map
AA seq 464 aa AA seqDB search
MILDQYVDILKDELVRSTQEIIKIKSTEGEPKPGMPYGEGPGKALEKALMIADSLGFKTK
NVDGYVGYAEYGEGDEMVGVLGHLDVVPEGDGWDYPPYGAEIHDGKIYGRGATDDKGPIM
ASLYALKAIKDSGLKLSKRVRILFGTNEETGSKEIEYYLKHEEAPTIGFTPDANYPVIYA
EKGITIFNVVKDFKEKSDELAIKYIKGGNRPNMVPDYCECAIVVKDEKRRESIPDEVKRF
RDVTGFDLDCSIENDMLVIKSHGVSAHGSLPYLGKNAIMQLILFLNVIYQQDDDVKKFVD
FFAKNVGLETNGKTFGVNLKDDTGELSFNVGTINLNEEKGTIGLNIRYPVTFKYEHLMNP
FNEKIGEYGMRVENMMHQPPLYFPKDHFLIKTLMKVYEDVTGRKDEPLSIGGGTYAKEMK
NMVAFGPIFPGKPDLDHQSNEYIEIDDLILNAKIYARAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatcagtatgtagatattttaaaggacgagttggtgaggtctacacaggag
attataaaaataaagagcactgaaggggagccgaagccagggatgccgtacggagaagga
ccaggaaaagctttagagaaagctctcatgattgccgacagtcttggatttaagacgaaa
aatgtcgatggatatgtgggctatgctgagtacggtgaaggagatgaaatggtaggagtt
cttggacatttagacgttgtcccggaaggtgatggatgggattatcctccatatggtgct
gaaatacacgatggcaaaatatacggcagaggagcaacagatgataagggcccaattatg
gcttctctttacgctttaaaggcgatcaaagattccggtcttaaattaagtaagagagta
aggatattgtttggcacaaatgaagaaacgggttcaaaagagatagaatactatctaaag
catgaggaagcacctacaataggttttactccagatgcaaattatccggtcatttatgca
gaaaaaggcatcacaatatttaatgttgtaaaagattttaaagaaaagtctgatgaattg
gctattaagtacataaaaggcggcaacaggccaaacatggttcctgattattgtgaatgt
gcaatagttgtcaaagatgaaaaacgaagagaaagtattccagatgaagtaaaaagattt
agagatgtgacaggctttgatttagattgcagtattgaaaatgacatgcttgtcattaag
tctcacggagtgtctgcacatggaagtctcccctatcttggcaagaatgccataatgcag
cttatattgtttttaaatgttatttatcagcaagacgatgatgtgaagaaattcgtagac
ttttttgcgaaaaatgtagggcttgaaacaaatggcaagacatttggagtaaatttgaaa
gatgacacaggagagctttcgtttaatgtcggcacaattaatttaaatgaggagaaaggc
accatcggactaaatataaggtatccggttacatttaaatacgaacacctgatgaatcca
tttaatgagaaaataggagaatacggaatgagggttgagaatatgatgcatcagccgcca
ctttattttccaaaggaccattttcttataaaaactcttatgaaggtttatgaagatgtg
acaggaagaaaagatgagcctctttcaataggaggagggacatacgctaaagaaatgaaa
aatatggtggcttttggaccgattttcccagggaaacctgatctagatcatcaatcaaat
gagtacattgaaatagatgacctcattttaaatgcaaagatatatgcccgtgccatatat
gagctggcgaaatag

DBGET integrated database retrieval system