KEGG   Thermoanaerobacterium thermosaccharolyticum M0795: Thethe_02686Help
Entry
Thethe_02686      CDS       T02407                                 

Definition
alcohol dehydrogenase, class IV (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tto  Thermoanaerobacterium thermosaccharolyticum M0795
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tto00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thethe_02686
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thethe_02686
   00620 Pyruvate metabolism
    Thethe_02686
   00650 Butanoate metabolism
    Thethe_02686
  Lipid metabolism
   00071 Fatty acid degradation
    Thethe_02686
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thethe_02686
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thethe_02686
   00626 Naphthalene degradation
    Thethe_02686
Enzymes [BR:tto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thethe_02686
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Thethe_02686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2694398..2696977
Genome map
AA seq 859 aa AA seqDB search
MATTKMETDVQKQIDLLVSKAQEAQKKFMSYTQEQIDAIVKAMALAGVDKHVELAKLAYE
ETKMGVYEDKITKNLFATEYVYHDIKNEKTVGIINENIEENYMEVAEPIGVIAGVTPVTN
PTSTTMFKCLISIKTRNPIIFSFHPKAIKCSIAAAKVMYEAALKAGAPEGCIGWIETPSI
EATQLLMTHPGVSLILATGGAGMVKSAYSSGKPALGVGPGNVPCYIEKSANIKRAVSDLI
LSKTFDNGVICASEQAVIIDEEIADEVKKLMKEYGCYFLNKDEIKKLEKFAIDEQSCAMS
PAVVGQPATKIAEMAGFKVPDGTKILVAEYEGVGPKYPLSREKLSPILACYTVKDYNEGI
KKCEEMTEFGGLGHSAVIHSENQDVINEFARRVRTGRLIVNSPSSQGAIGDIYNTNTPSL
TLGCGSMGRNSTTDNVSVNNLLNIKRVVIRKDRMKWFKIPPKIYFESGSLQYLCKVKKKK
AFIVTDPFMVKLGFVDKVTYQLDKANIDYEIFSEVEPDPSVDTVMNGVKIMNSYNPDLII
AVGGGSAIDAAKGMWLFYEYPQTEFETLRLKFADIRKRAFKFPELGKKALFIAIPTTSGT
GSEVTAFAVITDKKRNIKYPLADYELTPDIAIIDPDLTKTVPPSVTADTGMDVLTHAIEA
YVSVMASDYTDALAEKAIKLVFEYLPKAYKNGNDEVAREKMHNASCMAGMAFTNAFLGIN
HSMAHILGGKFHIPHGRANAILLPYVIKYNAEKPTKFVAYPQYEYPKAGERYAEIARFLG
LPASTVEEGVESLIEAIKNLMKELNIPLTLKDAGINKEQFEKEIDEMSDIAFNDQCTGSN
PRMPLVKEIAEIYRKAYGA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgacaaaaatggaaacggacgttcaaaagcaaatagatttacttgtatcgaaa
gctcaagaagcccagaagaaattcatgtcctatacacaggagcaaatagacgcaatagta
aaggcaatggccttagcaggcgtagataaacacgtggaactggcaaagctagcatatgaa
gagacaaaaatgggcgtatatgaagataagattacaaaaaatctctttgccacagagtac
gtatatcacgatataaaaaatgaaaaaactgtaggcataattaatgaaaacatagaagaa
aactacatggaagtagcagagccaataggagtcattgcaggtgtcacacctgtcacaaac
ccaacatccacgacaatgtttaaatgcttaatatccataaagacaagaaatcctataata
ttcagctttcatccaaaggctataaaatgcagcatagcggctgctaaagtaatgtatgaa
gcagcattaaaggcaggtgcacctgaaggttgcatcggttggatagaaacaccgtcaatt
gaagcgacacagcttctcatgacacatccaggtgtctcattaatccttgctacaggcggc
gcaggaatggttaaatcagcatacagctcaggcaaaccagcattaggcgtaggtcctggc
aatgttccgtgctacattgagaaatcagcaaacataaagagagctgtatcagacctcatc
ttaagcaagacatttgataacggagtaatatgcgcatcagagcaagctgtaataatagac
gaagaaatagcagatgaagtaaagaagcttatgaaggagtacggctgctacttcttaaat
aaagacgagataaagaagcttgaaaaatttgcaattgatgagcaaagctgcgcaatgagc
cctgcagtcgtaggtcagccggcaacaaagattgctgaaatggcaggttttaaagtccct
gatggcacaaagatattagttgcagaatacgaaggtgtaggtcctaaatatccactatca
agggaaaaattgagccctatacttgcttgctacactgttaaagactacaatgagggcatt
aaaaagtgcgaagaaatgacggaatttggaggtttaggccactctgccgtaatacactct
gaaaatcaagacgtaataaacgaatttgcaagaagagtccgcacaggaaggcttatagta
aattcaccgtcatcacagggagcaataggagacatatacaatacaaacacaccatcactt
acactaggctgcggttctatgggaagaaactctactacagacaacgtaagtgtcaataac
cttttaaatattaaacgtgttgtgataaggaaggatagaatgaaatggttcaagattcca
ccaaagatatactttgaaagcgggtcactgcagtatctgtgcaaagtaaagaagaaaaaa
gcctttatcgtcacagatccattcatggtaaagcttggctttgtagacaaagtgacatat
cagttagataaggcaaatatcgactacgaaatattctctgaagtagagccagatccatct
gttgatacagtcatgaacggtgtaaaaatcatgaattcatacaatcctgatctgataata
gctgtaggcggcggatctgcaatagacgcagctaaaggaatgtggcttttctacgagtat
cctcaaacagagtttgaaacgctgaggcttaaatttgcagacatcagaaagagagcattt
aagttcccagagcttggcaaaaaagcattattcatagcaatacctacaacaagcggcaca
ggctcagaagtcaccgcatttgctgtaataacggacaaaaagagaaatatcaaatatcca
ctggcagactacgaattaacacctgatatagcgataatagatcctgaccttacaaagaca
gttccaccgtctgtaacagcagatacaggtatggacgtcctgacacacgctatagaagca
tatgtgtctgttatggcttcagattatacagatgcactggcagagaaggcaataaagctc
gtatttgaatacttgccaaaagcatacaaaaacggcaatgatgaagtagcccgtgaaaag
atgcataatgcttcctgcatggctggtatggcatttacaaatgcattcctgggaataaac
cacagcatggcacacatactaggcggtaagttccacataccacacggaagagcaaatgca
atacttctcccatacgtcatcaaatacaatgcagaaaaacctacaaagtttgtagcatat
ccacagtacgaatatccaaaagcaggtgaaagatatgctgaaatcgccagattcttagga
ctacctgcatcaaccgttgaagaaggcgtagaaagcttaattgaagcaataaagaatctt
atgaaagagcttaatattcctctgacgcttaaagacgccggcatcaataaagaacaattc
gagaaggaaattgacgagatgtcagacatagcatttaatgaccagtgcacaggctcaaat
ccaagaatgccacttgtaaaagaaattgcagagatttacagaaaagcatacggtgcataa

DBGET integrated database retrieval system