KEGG   Thermobaculum terrenum: Tter_0119Help
Entry
Tter_0119         CDS       T01134                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00260  Glycine, serine and threonine metabolism
ttr00750  Vitamin B6 metabolism
ttr01100  Metabolic pathways
ttr01110  Biosynthesis of secondary metabolites
ttr01120  Microbial metabolism in diverse environments
ttr01230  Biosynthesis of amino acids
Module
ttr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tter_0119
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tter_0119
Enzymes [BR:ttr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tter_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACZ41041
UniProt: D1CDN5
Position
1:complement(130312..131610)
Genome map
AA seq 432 aa AA seqDB search
MSSSMAIDRDLKVKPKVRCIQCSAEKNLWTTVSSCECGGLLEIVWPLGEYEASWLKDTWA
SRMGSLLAIDRSGVWRFRELVSPVDGEAIITRGEGNTGLYNVPKLADWVGVDTLYLKHEG
ENPTGSFKDRGMTVGVSVARHCGAAIVACASTGNTSASLASYAAIADMRCVVLLPAGKVS
AAKLSQSIAYGAKTIAIRGDFDKALSLLQSTAPQLGLYILNSVNPWRLEGQKTVMYELLE
SLRWEVPDWIFLPGGNLGNTSAFGKALLEMRSLGLIDSLPRIGVVQAEGAAPFAHAYKSG
WQSYSPVKAETVATAIRIGDPVNYQKARRVVQELDGLVTSVSDREILDAKAMVDGAGVGC
EPASAASVAGIRKLMSERIISPDSKVVAVLTGHILKDPDATFMYHTSDNRFSNKIIEVDA
DPKSIISVVESL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttctatggctatagatcgagacctaaaagtaaagcctaaggtaaggtgcata
caatgtagtgcagagaagaatctctggactacagtctcttcctgtgagtgtggggggttg
ctagagattgtttggcctcttggcgaatatgaagcttcttggctcaaggatacatgggca
agcagaatgggttctctattggctattgatcgaagtggcgtatggaggttccgggaacta
gtctcaccagtcgatggtgaagctatcattactcggggtgaagggaatacgggactgtac
aatgtgcctaagctcgctgattgggtgggtgtcgataccctttatctgaagcatgaggga
gagaaccctaccggatccttcaaggacaggggaatgaccgtgggggtgagcgtagctcgc
cactgtggagcagctattgtcgcctgtgcctccacgggcaacaccagtgcctctctagct
tcttacgcagctatagccgatatgcgttgcgtggtgctgctgccggcgggcaaggtctca
gctgcaaagctctcccagtctatagcttatggcgcaaagacgatagccatcaggggagat
tttgataaggctttgagccttctacagtctactgctcctcagttaggactatacatacta
aattctgtaaacccttggaggcttgagggccagaaaactgttatgtacgaattgcttgag
tctctgagatgggaagttcccgactggatatttctcccaggtggtaatcttgggaatacc
tcagcatttggtaaagctcttctagaaatgcgaagcttagggttgatagatagtttacct
cgaattggtgtggttcaagctgaaggtgcagctccctttgcccatgcttataaatctgga
tggcagagctattctccggtcaaagcagagactgtagccactgctatacgtataggcgat
cctgtaaattatcagaaggctaggagagtggtacaagagcttgatggattagtgacatct
gtcagtgatcgagaaattctggatgccaaggctatggtggatggtgctggggtgggatgt
gaacctgcaagcgcggcctcggttgctggtatacgaaagttaatgtccgaaagaataatc
tctcccgattctaaggttgtggctgtcctcaccggacacatactcaaggatcctgatgct
actttcatgtatcacacttcggacaataggttctctaacaagataattgaggttgatgct
gatcctaaatctattatctcggtggtagaaagtttatga

DBGET integrated database retrieval system