KEGG   Thermobaculum terrenum: Tter_0137Help
Entry
Tter_0137         CDS       T01134                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ttr  Thermobaculum terrenum
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ttr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ttr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:147834..149153
Genome map
AA seq 439 aa AA seqDB search
MPKITFIGAGSTVFAKNLIGDILSFPELQDSTICLFDIDPDRLSTSEIVANKIKQALNAP
AKIEATTDRRKALYGADYALCMIQVAGYKPGTVIDFEIPKKYGLRQTIADTLGIGGIMRA
LRTIPVLLDMCKDMEELCPDVYFLNYVNPMAMNCWAISRASKIKTVGLCHSVQGTAWELS
KDIGVPLEEINFVCAGINHMAFYLKFERNGEDLYPLIRKVIEEGRVPEHNRVRYDVFKRF
GYFVTESSEHFSEYVPWYIKRDRPDLIEKYNIPLDEYIRRCEAQIAGWEELRKRYESDEP
IQVERTHEFASYIIHSIETGIPKLDEKGNTRVIYGNVPNNGLIDNLPQGCCVEVPCLVDR
NGIQPIKIGSLPIQLAALMQTNINVQALTVEAALTRKKEYIYQAAMLDPHTAAELDPDQI
YSLVDELIAAHGDWLPEYH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagatcacatttatcggagctgggagtaccgtctttgccaaaaatctcatagga
gatatcctctcttttccagagctacaggactcaactatatgtctatttgatatagaccca
gatcggctctcgacatcagagatagtagctaacaagataaagcaagccctcaatgcacct
gccaagatagaggctactactgatcgcaggaaggcactgtatggagctgactatgcccta
tgcatgatccaggtggctggatacaagccaggaacagttatagacttcgagatccccaag
aagtacggtctaaggcagaccatagctgataccttaggtattggcggcataatgagggcc
ctcaggaccatacctgtgctcctagatatgtgcaaggacatggaggagctatgtccagat
gtgtacttccttaactatgtaaatcccatggcgatgaattgctgggcgataagccgtgct
agcaagataaagactgttggcctatgccacagcgtccagggaacggcatgggagctatcg
aaagacataggagtgccccttgaagagatcaacttcgtgtgtgccggcataaaccatatg
gcgttctatcttaagttcgagaggaacggagaagatctatatccgctaataagaaaggtc
atagaagaaggaagagtaccggaacataatcgcgtgagatatgacgtgttcaagagattt
ggatactttgtgacggaatcaagcgagcacttcagcgaatacgttccctggtatataaag
agagacagaccagacctaatagagaaatacaacatacctctcgacgaatatataagaaga
tgcgaggcacaaatcgctggctgggaagagctacgcaagcgttacgagagcgatgagccc
atacaagtcgaaaggacacacgagttcgcctcttacatcatacatagcatagagacaggt
attcccaaactggatgaaaagggtaacacccgtgtaatctatggtaacgtacctaacaac
ggcttgatcgacaaccttcctcagggatgctgcgtcgaagttccatgcctcgtagataga
aatggcatccagccaatcaagataggttctctgccaatccagctggcagcactaatgcag
accaacatcaatgtgcaagccctcactgtagaggcagcactaaccaggaagaaagagtat
atctatcaggcggcgatgctcgacccacatactgcagctgaacttgatccggatcagata
tattctctggtagatgaactcatagctgcccatggcgactggctgccagaatatcactaa

DBGET integrated database retrieval system