KEGG   Thermobaculum terrenum: Tter_0216Help
Entry
Tter_0216         CDS       T01134                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ttr  Thermobaculum terrenum
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tter_0216
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tter_0216
   00600 Sphingolipid metabolism
    Tter_0216
Enzymes [BR:ttr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tter_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(232141..233466)
Genome map
AA seq 441 aa AA seqDB search
MPKIAFIGAGSAVFTRNLLGDLLTYPELDGSTISLMDIDANRLKAVESLAKKMVEQEGSK
MVIEATTDRSQALQNADYVVITIQVGGLKAYELDIEIPRKYGVEQCVGDTIGPGGVFRGL
RHLAVIEEICNDLEELSPDALILQYTNPMAILCWGISSMSSIRFVGLCHSVQGTSEELAH
IAGVPYEELSYWVAGINHMSWFLRLEHKGRDLYPLLFEKMSDPDTYALDPIRFDLMKHFG
YFVTESSGHASEYYPYFRKRQDVLEQTLAKFTHPRHGWFKFGQTGGYLKHCFEVADHYYE
DIEDQLKADKIEIRRSREYGAQIIHSIETNTPRRINGNVTNYDLITNLPYGCCVEVPCLV
DNTGINPCYVGDLPPQLAGLIRTNVNLQELAVLGHIHRDKTLVKQAIKMDPLTAAVCSLE
EIDNMVDELFDAQKEWLPQFD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaagattgctttcataggggcaggcagtgctgtttttacgcgcaatctgttgggc
gacttactaacttatccggagcttgatggcagcaccatatcgttaatggatattgatgct
aatagattgaaagctgtagaatccctggcaaagaagatggtagagcaggaaggctctaag
atggtaatagaggctaccacggaccgcagccaagcgcttcaaaacgcggattacgtggtg
ataactatccaggtaggagggctcaaagcttacgagctcgacatagagatccctagaaaa
tatggggttgagcagtgcgtgggagatactattggccctggtggtgtatttagagggcta
cgtcacttggcagtaatagaggagatatgcaacgatctggaagagttaagtcctgatgct
ttgatacttcagtacaccaatcccatggctatattgtgttggggtattagctctatgtca
tctatcaggttcgtagggctttgtcatagtgtgcaaggcacttcggaggagctggcgcac
atagcaggagtgccctacgaagagttatcttattgggtggccggtataaaccatatgtcc
tggtttctaaggttggagcataaggggcgtgacctttatccactgttatttgagaagatg
agcgatccggatacttatgctcttgatccaattaggtttgacctaatgaagcactttggt
tatttcgtaactgagtccagtgggcatgcttccgagtattatccttatttccgtaagaga
caggacgtgttggagcaaaccttagccaagttcacccatcctaggcatggttggttcaaa
tttggtcagacgggaggttatctcaagcattgcttcgaagttgcagaccattattacgag
gatatagaagatcagctcaaagctgacaagatagagatcaggagatccagagagtatgga
gcacagataatccactccatagaaactaataccccgagaagaatcaatgggaacgttacc
aactacgatctgataaccaacctgccttacggttgttgcgtggaagtaccatgcttggtg
gataacacgggcatcaatccatgttatgtgggggatttaccgcctcagttggcaggtttg
atacgtacaaacgtcaatttgcaagaacttgcggtgttgggtcatatacatcgggataaa
actcttgtgaaacaggcgatcaagatggatccgctcaccgcagctgtgtgctcactggag
gagatcgataacatggtcgatgagctgtttgatgctcagaaagagtggctaccccagttt
gattag

DBGET integrated database retrieval system