KEGG   Thermobaculum terrenum: Tter_0244Help
Entry
Tter_0244         CDS       T01134                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ttr  Thermobaculum terrenum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tter_0244
Enzymes [BR:ttr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tter_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:259790..261304
Genome map
AA seq 504 aa AA seqDB search
MNDHRRSGVLLHLTSIPTKYSIGDMGPKAYEFLDFITSSGLSIWQMLPVGPVGKSNSPYQ
SYSAFAGNHLLISPDLLLEEGILATADLPKEPNTKHQRTDYALARRIKSLILQKAFSRFT
PTKDFESFCEEYSYWLDDYAMFMTLLELNNGRPWNLWHTDISRRDKTTLERLSREHKQRI
MFHKFAQYLFFKQWFELKKACNSRGVKILGDLPIFVAHNSADVWAHPEIFKLKPDGNPRM
IAGVPPDYFSSTGQLWGNPLYDWQMLEAQNYSWWIDRLKWSLKLFDMVRIDHFRGFCACW
EVPYGETTAVNGRWVKVPGAKFFRTAIKALGSLPVIAEDLGVITPEVEALRDKFGFPGMK
VLQFAFTNPQNQYLPHNYVTFNCVVYTGTHDNNTTLGWWEELDSKHKSIVRSYVGRKTGK
DLVWELIRMGISSTAKYAIFPLQDFLTLGSEARMNIPGTEFGNWEWSYPESALSEEIAGR
IKHLCKLYNRVPPEEKEQQITNPQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcacagaagaagtggtgtgttacttcacctaacatcaatccccaccaagtac
tctataggagatatggggcccaaagcttatgaatttctggattttattacaagtagcggg
ctaagcatatggcaaatgttaccggtaggtccagttggaaaatctaattctccgtaccaa
tcctattcggcctttgccggcaaccacctactgataagtccagatctgctgctcgaggag
ggaatactggcaacagcagacttaccaaaagagcctaataccaagcatcagcggacagat
tatgccctcgcaagaaggataaagtcactcattctacagaaagccttctcaaggtttacc
cctaccaaggattttgagtccttttgcgaagaatacagctactggctagatgattatgca
atgttcatgacactccttgagctgaataatggtaggccctggaacctttggcacactgat
atctccagaagagacaagacgacgctagaaagattaagtagagagcataagcaaaggata
atgttccataagttcgcccaatacttgttcttcaagcaatggtttgagctaaagaaggca
tgtaattctcgcggcgttaagatcctaggagatctgcccatatttgttgctcataacagc
gcagatgtttgggctcatccagaaatatttaagctcaaaccagatggtaacccacgcatg
atagctggtgttccaccggactatttcagcagcaccgggcagctatggggcaaccccctc
tatgactggcagatgctagaagctcaaaattattcttggtggatagatagactcaagtgg
tcacttaagctctttgacatggtaaggatagaccatttcaggggtttctgcgcttgctgg
gaagtaccatatggagaaacaaccgcagtaaatggtaggtgggtaaaggttcctggggca
aagttcttcagaacagccataaaagctttaggttcactgcctgtaatagctgaagactta
ggggttatcactccggaagtagaagcgctgcgtgacaagtttggcttcccgggcatgaag
gtactacagtttgcattcacgaacccacaaaatcagtacttgcctcacaactacgtaacc
ttcaactgtgtagtgtataccggcacgcacgacaacaacactacactgggttggtgggaa
gagctagacagcaaacataaatctatagttagaagctatgtagggagaaaaactggaaag
gatttagtatgggagcttattagaatggggatctcctcgactgcaaagtatgcaattttc
ccgctacaagattttctaactctcgggtcagaggcgaggatgaacatccctggtacagag
ttcggaaactgggaatggagttatcctgaaagtgcgctatccgaggaaattgcaggcaga
ataaagcatctatgcaagctgtacaatagggtacctccagaggagaaagagcaacagatt
acaaatccccagtaa

DBGET integrated database retrieval system