KEGG   Thermobaculum terrenum: Tter_0289Help
Entry
Tter_0289         CDS       T01134                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00020  Citrate cycle (TCA cycle)
ttr00640  Propanoate metabolism
ttr00660  C5-Branched dibasic acid metabolism
ttr01100  Metabolic pathways
ttr01110  Biosynthesis of secondary metabolites
ttr01120  Microbial metabolism in diverse environments
ttr01130  Biosynthesis of antibiotics
ttr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tter_0289
   00640 Propanoate metabolism
    Tter_0289
   00660 C5-Branched dibasic acid metabolism
    Tter_0289
Enzymes [BR:ttr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tter_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: ACZ41211
UniProt: D1CE55
Position
1:complement(310095..311243)
Genome map
AA seq 382 aa AA seqDB search
MNLHEYQSREILAKHGIPIPPGILARSVEEAVEAASSLGYPVVIKAQVHSGGRGKAGGIK
LVNSQRELEYVAPTILSMNIGGRPVSALLVVPAADIQKEYYLSVVLDRELKTFTLIASAE
GGVDIEEVAREHPDSILRVPAHPWLGLQPYQARELAYKVGFEGSLVRTFVEIAMSLYRCA
LDVEASLVEINPLAKVSSGDLIALDSKIVVDDNSLFRHPDIAEMRDLSQEETAEVEASRV
GISYIKLDGNIGCMVNGAGLAMATMDLVKLYGGSPANFLDIGGGAHADQVEAAMNIILSD
EKVSAVLINIFGGITRCDDVARGIVEGLRNIKRGVPIVVRLVGTNEEEGHRILEDAGLRS
LSSLEEAAKLAVELASKSTVSR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgagtatcagtcaagggaaatacttgccaaacatggcattcctatccca
cccggaatattggcaagaagcgtggaagaggctgttgaggcagcctcttctcttggttat
cctgtagtaattaaggctcaggtgcattctggagggagaggcaaggctggcggtataaag
ctggtaaactcgcagcgagagcttgaatatgtagctccaactatactaagcatgaatata
ggcggccgccctgttagtgctcttttggttgttcccgctgccgatatacaaaaagaatat
tatctcagcgtagtgttagatagggagctgaaaaccttcacccttattgccagtgctgaa
ggcggggtagatatagaagaggttgctcgcgaacatcctgatagcatcttgagagtgccc
gcccatccttggctaggactacagccttatcaagcaagagagctagcctacaaagtgggt
ttcgagggctcgctcgttaggactttcgtagaaatagcaatgtctctctacagatgtgct
ctggatgtggaagctagtcttgtggagataaatcccctggccaaggtttcctctggtgat
ctgatagcgctggattccaagatcgtcgtggatgataactctctatttagacatccagat
atagctgagatgagagatctaagccaggaggagactgctgaggtagaggcctctcgagta
ggtataagctacataaagctcgatggtaacatcggatgtatggttaacggagctggtcta
gcaatggctaccatggatctcgtaaagctatatgggggtagtccagctaacttcctcgat
ataggtggtggagcgcatgctgatcaagttgaagctgcgatgaatatcattctatctgat
gagaaggtaagtgcggtcttgatcaatatatttggtggcataacgagatgtgatgatgtg
gctcgtgggatagtagaggggcttagaaacatcaaaagaggagtgcctatagtggtcagg
ttggtaggaaccaatgaggaggaaggtcataggatacttgaggatgcaggacttagatcc
ctatcctctttggaagaagctgccaagctggctgttgaacttgcctccaagagcacggtc
tctagataa

DBGET integrated database retrieval system