KEGG   Thermobaculum terrenum: Tter_0303Help
Entry
Tter_0303         CDS       T01134                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00010  Glycolysis / Gluconeogenesis
ttr00071  Fatty acid degradation
ttr00350  Tyrosine metabolism
ttr00625  Chloroalkane and chloroalkene degradation
ttr00626  Naphthalene degradation
ttr01100  Metabolic pathways
ttr01110  Biosynthesis of secondary metabolites
ttr01120  Microbial metabolism in diverse environments
ttr01130  Biosynthesis of antibiotics
ttr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tter_0303
  Lipid metabolism
   00071 Fatty acid degradation
    Tter_0303
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tter_0303
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tter_0303
   00626 Naphthalene degradation
    Tter_0303
Enzymes [BR:ttr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tter_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACZ41225
UniProt: D1CE69
Position
1:324891..325889
Genome map
AA seq 332 aa AA seqDB search
MKAQMLSEQLSIDRRPLKLVEVDEPSIGQKDLLIKVKACGVCHTDLHIVEGDIPLHKRPI
VPGHQIVGVVEKVGEAVTRFSPGDRVGVPWLNWACGRCEYCQRGYENLCVNGKFTGWDVD
GGYAEYQVTSEDFTYHIPDGYSDLQAAPLLCAGVVGYRALKLAKADNAERVGLYGFGASA
HIAIQVLRYWGTRVFVFTRSREHQKLALELGAEWAGTANDDPGVLMQSSIIYAPAGDIIP
QALGVLDKGGVLSLAGIYMTPIPQLDYELLRGEKVIVNVTNATRQDAIELLDLAPRVPIR
TEIEVYPLEEANDVLLRLKESKINGSAVLQIS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacaaatgctttccgagcagttatcaatcgatagacgcccacttaaacttgta
gaggtggacgaaccttctattggccaaaaagatctgcttataaaagtcaaggcgtgtgga
gtatgccatactgatctccatatagttgaaggtgatatacctttgcacaagcggccaatt
gtacccggccatcagatagtaggtgtggtggagaaagtaggtgaggctgtcacacgcttc
tcccctggagatcgagtaggggtaccctggcttaactgggcatgtggtagatgtgagtac
tgccagagaggatatgagaatctctgcgtgaacggcaagttcactggttgggatgttgac
ggcggctatgctgagtatcaagtcacaagtgaagactttacatatcatatccctgatgga
tattcagacctgcaagctgctcccctactatgtgctggagttgtgggttacagggctcta
aagcttgctaaggctgataatgctgagcgagtgggcctatatggttttggggcttctgct
catatcgccatacaggtgctaaggtattggggaacgagggtctttgtctttacccgtagt
agagaacaccaaaagcttgccctggagctgggtgccgaatgggcaggtactgctaatgat
gatcctggagtgttgatgcagtcgtccataatttatgccccggcaggtgatatcattccg
caggcccttggagtgctggataaaggtggggttctgtctctagcaggtatatatatgaca
cctatacctcaattagattatgagctgctgcgcggagagaaagttatagtgaatgttaca
aatgcaaccaggcaagacgctatagagcttctggaccttgcacctagggtgccgatacgt
accgagatagaggtatatcctctagaagaagccaacgatgtgctattaagactcaaggaa
agcaagataaacggttcagctgttttacagatatcataa

DBGET integrated database retrieval system