KEGG   Thermobaculum terrenum: Tter_0332Help
Entry
Tter_0332         CDS       T01134                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ttr  Thermobaculum terrenum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tter_0332
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tter_0332
  Amino acid metabolism
   00310 Lysine degradation
    Tter_0332
Enzymes [BR:ttr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tter_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(360764..362014)
Genome map
AA seq 416 aa AA seqDB search
MAVEIRVPDLGESVVDVTVLKWHKQPGDSVEEGDVVVELETDKANVEVPAPSSGFLESIS
IQEGESASVGDLLGTITETPSQAREPSQPEAPQEREAVSPQAAHHTEVQPKATPSVRRLA
EELGIDISKIEGSGAGGRITREDVLAMRQAPSGAQQAESSKTVEAQPIKETTPAPSEAPA
RELSELERRERMSTRRRVIARRLVEAQHTAAMLTTFNECDMSNVIEIRRRLGPRFQEKYG
VKLGFMSFFTKAVVAALKEFPYLNAEIDGEDIILKYHYDIGIAVGAKEGLVVPVIRNADR
KSFAEIEKEIDELATKVRNNTISLEEVRGGTFTITNGGIYGSLLSTPILNPPQVGILGMH
AIKERPVVVEGQVVVRPMMYLALTYDHRIVDGSDAVRFLVRIKELIEDPTSLMLES
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgagatcagagtgcctgatcttggagaatccgtagtcgatgttacagttcta
aagtggcataaacaaccaggagacagcgtagaagaaggggatgtagtcgttgagcttgaa
acagacaaggccaacgtagaggttccagctccttcgagcggattcctggagagtatctct
atacaggaaggagaatctgcctccgtaggtgatctgcttggaacaatcacggaaacccct
tcacaggccagggaaccatcacaacctgaggctcctcaagagagggaagcagtcagccct
caggctgcgcatcatacagaggtacaacccaaggcaacaccttctgtacgcagactggcc
gaagagttaggtatagacatctcaaagatagagggatctggagcgggcggcagaatcaca
cgggaagatgtgctagctatgaggcaagctccgtccggagcgcaacaggcggaatcaagt
aaaactgtagaagctcagcccattaaggaaaccacccctgccccctcagaagcccctgca
agggagctatcagagctggagagacgagagcgcatgtctactcgtcgtagagttatagcc
cgtcgattggtagaagctcagcatacagccgctatgcttactaccttcaacgaatgtgat
atgagcaacgttatcgagatacgccgaaggctgggtcccaggtttcaggaaaagtatggc
gtcaagctcggcttcatgtcgttcttcacgaaagcagtagttgccgctctcaaggagttc
ccttatctcaacgctgagatagatggcgaagacataattctgaaataccactacgatata
ggcatagccgttggcgccaaagaaggattagtggtgcctgtgattagaaacgcagaccgc
aagagcttcgcagagatagaaaaggagatagatgagcttgctaccaaggtaagaaataac
actatatctttggaagaggtacgtggaggaaccttcactataaccaacggaggtatttat
ggttccctgctatcaacccccatactaaatcctccacaagtaggtatcctcggaatgcac
gcaatcaaggaaaggccggttgtggtggaaggacaagtagtggttcggcctatgatgtac
ctagctcttacttatgatcacaggatagtagatggaagtgatgcggtgcgcttcctcgtg
cgtatcaaggagctaatagaagaccctacttctctcatgctcgagagctag

DBGET integrated database retrieval system