KEGG   Thermobaculum terrenum: Tter_0354Help
Entry
Tter_0354         CDS       T01134                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ttr  Thermobaculum terrenum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tter_0354
Enzymes [BR:ttr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tter_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:383419..384345
Genome map
AA seq 308 aa AA seqDB search
MTARVVVVGSSNTDMVVPVPHIPGVGETVLGGDLIIAPGGKGANQAVAAARLGAEVVFIG
AVGSDDFGQKAIKGLNADGIDTSYVKIVDGTPSGVALIMVDPSGNNSIAVSPGANSRLFP
EDIELSSKVLQNARILLTQLEVPLDTVATALEFGKKMDCVTMLNPAPAPATGLPSDIISH
VDVITPNEVEARALVGRDMPSEDLAKALLDLGVKIVILTLGERGALVAQQDKLVAVEPFA
VSPVDTTAAGDAFSGALAVAIAEGLELIDAVRFANAAAALSVTKMGAQPSMPTRAELETF
LSRHQISG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacagctagagtggtggttgttggtagcagcaatactgatatggtggtacctgtccct
catatccctggagtgggggagacggtgctgggtggggatctgattattgcccccggtggg
aagggggccaaccaggctgtggctgctgctaggctgggtgcagaggtggtttttatcggc
gctgtaggtagtgatgactttggtcaaaaagccatcaaggggcttaatgcagatggtata
gatactagctacgttaaaatagttgatggaacccctagtggtgttgccctgataatggtg
gatccttcgggcaataactccatagcagtctccccgggagcaaactctcgtctgttccca
gaagatatcgagctcagctcaaaggtcctacaaaatgccaggattttgctaactcagctt
gaggttcctctggatacggtagcaacagccctggaattcggtaagaaaatggattgtgtg
actatgctcaatccagcacctgctcctgctacagggctcccaagtgacattatctcccat
gtagatgtgatcactcctaacgaagtagaggccagggcactggtgggacgtgatatgcca
tctgaagacttggccaaggcgctgttggatctgggggtgaaaatagtcatactaaccttg
ggggagagaggggcgctagtggcccagcaagataagttggtagcggtggaaccttttgca
gttagtcctgtggatactacagctgctggtgatgcctttagtggggcattggcggtagca
atagctgaggggcttgagctaatagatgcggtacgctttgctaacgcagcggctgctcta
tctgttactaagatgggcgctcagccgtccatgcctactagagcagagcttgaaaccttc
ctctctagacatcaaatttctgggtaa

DBGET integrated database retrieval system