KEGG   Thermobaculum terrenum: Tter_0445Help
Entry
Tter_0445         CDS       T01134                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ttr  Thermobaculum terrenum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ttr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ttr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(491848..493638)
Genome map
AA seq 596 aa AA seqDB search
MVPTIKRLLMAICILVLIGISACQDVVYRGSAITHASSSSWAEATLSKMTLREKIGQMFA
VYVYGDSAYDTDPWAVNANRKLYGVDNASQIIQKYHVGSIIYFTWTGNIKNAQQVARLSN
GIQRSSMTQRVPVPTLISTDQEGGIISRLPSQIVRSPGNMALGAARDKTYAFRAAYIVGK
ELRALGINQNLAPDADVNINPFNPVIGVRSFGDRSWLVARLTAAQVRGYQSVDVAATAKH
FPGHGDTNIDSHTGLPVIRHTQKQLEDIDLPPFRAAIDSGVDVIMSAHIVVPSLDPSGRP
ATLSKPILTGLLRQKLGFKGVIMTDSLEMAGVRQMFPDSRVPVEAIKAGADLLLMPPDLN
LAINSVVNAVERGEISVSRINASVLRILELKARLGLPANPYVDADSVSSHVKTHWHILSA
ADISNHTITIIRNSGVLPLKPNSGRTVLVTGWGDEPTIEVAAKMSSYGVRVTRYSTGDHP
SSSVRDHAVYLARQKSLVVVLTRDIQWDTRQRELVKSLIQTGKPVIVLSVELPYDLAYVT
SAKTYVATYSYNPVSLRAAVRVMFGKASPVGKLPVRIPKANAPQETLYPFGYGLGY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggtacctaccatcaaaagactactgatggctatttgcattctcgtattgataggaata
tcagcttgccaagatgtggtctatcgaggaagtgcgataacccacgcatcatcctcaagc
tgggcagaggccaccttatccaaaatgacccttagagaaaagatagggcagatgtttgca
gtgtacgtctacggagatagcgcttacgacacagatccctgggcagtaaatgcgaacagg
aaactatacggtgtggacaacgcatctcaaataatacagaagtatcatgttggtagtatc
atatatttcacatggactgggaacattaaaaatgcccagcaggtagcaaggttatcaaat
ggtatccaaagaagctccatgacccaaagagtaccagttcccacgctcatatctacggat
caggagggaggcataatatcaaggttaccttctcaaatcgtccgttcccctgggaatatg
gcgctaggagccgcaagagacaaaacgtacgcatttagagccgcttacatagtcggcaaa
gagctcagagctctagggatcaatcaaaacttggccccggatgctgacgtaaatatcaac
ccattcaacccagtgataggtgtaaggtcctttggggacagatcatggcttgtggccaga
ctaacagctgcgcaagtgagagggtatcaaagcgtcgacgtagcagcaacagccaaacat
tttcctggacacggcgatacgaacatcgacagccatacaggactgcccgttataaggcac
acccagaagcagctggaagatatagatctgcctcctttcagagctgctatcgattcagga
gtcgacgttatcatgagtgcccacatagtcgtgccttcgctagacccttcgggtaggcca
gcaaccctctccaaaccgatcctaacagggctactacgccaaaaacttgggttcaagggc
gtaataatgacagattctctagagatggcaggggtccggcagatgtttccggatagcaga
gtgccagtggaagctatcaaagctggagcagatctgctacttatgcctccggatctaaac
ctagcgataaactcggtagtaaatgccgtggaaagaggagagataagcgtttctcgcata
aacgcttcggtgctacgtatcctcgaacttaaggcgcgactggggttgccagcaaatccc
tacgtcgatgccgactcggtaagcagccatgtcaagactcactggcatatccttagcgcc
gctgatatctctaaccacaccatcactatcatccgcaattcgggcgtgcttccactgaaa
cccaattcgggtcgaacagtcttggtaactggttggggagatgaacccacaatagaagta
gccgcaaagatgtccagctatggcgtaagagtcacgaggtactccacaggggaccaccca
tcttcgagcgtgcgtgaccatgcagtctacctggcaaggcagaagagcttggtagtcgtg
ctaactagagatattcaatgggatactaggcagcgagagcttgtgaaaagcctgatacag
acagggaaaccagtaatagtactctctgttgagcttccgtatgatttagcttatgttaca
agtgccaagacctacgtggcgacctatagctataaccctgtctctttgcgggcagcggtg
agagtaatgtttggaaaagcttcacctgtaggcaagttgcctgtacgcattccaaaagcg
aacgccccccaggagactctttatccatttgggtatggcctggggtactag

DBGET integrated database retrieval system