KEGG   Thermobaculum terrenum: Tter_0470Help
Entry
Tter_0470         CDS       T01134                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ttr  Thermobaculum terrenum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ttr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(519071..520570)
Genome map
AA seq 499 aa AA seqDB search
MSKYVLALDQGTTSSRAIIFDQEGNIVSLAQRPIDQIYPHPGWVNQDAEHIWEVTLSVMK
EAVQQSQLGISQIAAIGITNQRETTILWDRATGKPVGPAIVWQSRQTSHLVDDIFRRGKA
ERYQQITGLVPDAYFSATKILWMLEQDPEVRRRAEQGDLAFGTVDSWLLWKLSGGKVHLT
DYSNASRTMLFDINELEWSDELLADLNIPKHILPGLCDNSGIICHADSSILGAEIPVAGV
AGDQQAALFGQTCFSPGEAKNTYGTGSFCLMNIGEKPTHSKHKLLTTIAWGINGKVEYAL
EGSIFVTGAAVGWLRDGLGIIKTSEEVEQLASSVKDSGGVFFVPALVGLGAPYWDQYARG
TIIGITRSTTAAHIARATLEAIAFQTRDVVEAMIADSGIDLHELRVDGGAVKNDLLLQIQ
ADILGVPVVRPTMTEVTALGAAYLAGLATDVWADQQDLKAHWKEDRRFEPSINADQRESL
YSTWKRAVERACRWEKPTE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatatgtgcttgccctggatcagggcacaacatcaagcagagctataatcttt
gaccaagaggggaacatagtatctctagctcaaagaccaatagatcagatctatcctcat
ccaggctgggtcaatcaggatgctgagcatatatgggaagtaaccctctcggtgatgaag
gaagcagtccagcaatcacagctgggcatctctcagatagctgctatcggtatcaccaat
cagcgagagacgacgattctctgggatagagccacaggcaagcctgtaggcccagcgatc
gtctggcagagcaggcaaacatcccatctagtggacgatatattcaggcgaggcaaggcg
gagagataccagcagataactggacttgtgccagatgcttacttctctgccaccaagatc
ctctggatgctggagcaagaccccgaagtgcgcaggagggctgaacaaggtgatctggct
tttggcacggtagatagctggctactatggaagctttccggaggcaaagtacatctcacc
gattattccaatgcatctcgcaccatgctctttgatataaacgagctcgaatggtctgat
gagctattggcagacttgaatatccctaagcatatactcccaggtttatgcgacaattcc
gggattatctgccatgctgatagcagcatcctcggcgctgagatccctgtagcgggagtg
gctggagatcagcaagcagccctatttgggcagacttgtttttcacctggggaagcgaag
aatacctacggtacaggctccttctgtctcatgaacataggggaaaagcctactcattca
aagcataaattgcttaccactatagcttggggtatcaatggcaaagtcgaatatgctctt
gaaggctcaatatttgtcaccggagcagcagttggttggctcagggacggtttgggaatt
ataaagacctcagaagaggtagagcagttagcctcctctgtgaaagatagtggtggtgtc
ttcttcgtgccggcgctggtgggactgggggcaccatattgggatcaatacgctcgtggt
acaataattggtatcacaagaagcactacagctgcgcatatagctcgagctaccctggaa
gcgatagccttccagacaagggatgtggtagaagctatgatcgccgattccggcatagac
ctgcatgagcttagagttgacgggggtgctgtaaagaacgacttgctcctacagatacag
gctgatattcttggtgttccagtggtacgaccgaccatgacagaggtaactgcactgggc
gccgcctatctggcaggattggcaaccgatgtatgggctgaccagcaagatctgaaggca
cactggaaggaagaccgtagatttgagccttccatcaacgcagatcagagagaatctctc
tactcaacttggaagcgggctgtagaaagagcttgtaggtgggaaaaacccactgaataa

DBGET integrated database retrieval system