KEGG   Thermobaculum terrenum: Tter_0679Help
Entry
Tter_0679         CDS       T01134                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttr  Thermobaculum terrenum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tter_0679
   01230 Biosynthesis of amino acids
    Tter_0679
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tter_0679
   00030 Pentose phosphate pathway
    Tter_0679
   00051 Fructose and mannose metabolism
    Tter_0679
   00052 Galactose metabolism
    Tter_0679
  Energy metabolism
   00680 Methane metabolism
    Tter_0679
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tter_0679
Enzymes [BR:ttr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tter_0679
Protein phosphatases and associated proteins [BR:ttr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tter_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:739000..740214
Genome map
AA seq 404 aa AA seqDB search
MAVKGNLIVGQSGGCTAVINSSLVGVVQTALKSPAVGEVYGMLHGVEGLFRSEVVDLRAE
PDGVWEEIKKTPSAALGSNRYKLSDDDIDRALQILRSLDVRYFIYIGGNDSADTAHRIAL
AAQAANYELYAVAVPKTIDNDLPYTDHSPGYGSIARFISTVTQEIGLDTEAMRRVDPVKI
LEVMGRDAGWVAASSILGKVRETDAPHLIYVPERPLVREKFLEDVENCYRKYGYVLVVVA
ETVRDENGNHIARVDPVFSQDAFGHKYISGTAAYLADLVSRDLGLRARYDKPGTIQRMSM
AMASQVDLEEAYMVGRYAVEEVTKGTTNRMVTIERISNDPYMSKPGLVELEKIANQQKLL
PEEYISPEGNFVTKAFVEYAMPLIGGSAVSFPRLQGKRIALKTI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttggctgtaaaaggtaacctgatagtaggtcaatccggtggctgtacggcggttataaac
tccagtttggtcggagtggttcagactgccctgaagagtcctgctgtgggtgaagtttac
ggtatgttgcacggtgtggaaggtttgttccgtagcgaggtagtagacttgcgagctgag
cctgacggtgtatgggaagaaatcaagaaaacaccatctgctgcactaggctccaatcgt
tacaagctctctgatgatgatatagatcgagctctacagatcctgcgctctctggatgta
aggtactttatttatataggtggtaacgattccgcagatacagcccataggatagcctta
gcagctcaagcagcaaattacgaattatatgcggtagctgtgccgaagaccatagataac
gaccttccatacacagaccactctcccggctatggaagcatagctcgatttatctccaca
gtcacccaggagattggtctagacaccgaagccatgcgtagggtagatccagtcaagatc
ctagaggttatgggtagggatgctggatgggtagctgcctcatcgatccttggtaaggtc
agagagacggatgcgccacatcttatatatgtgcctgagcggccattagttagggagaag
tttctggaagacgttgagaattgctatcggaagtacggctatgtgctggttgtagttgcc
gaaacagtgcgagatgagaacggcaaccatatagctagggttgatccggtatttagtcaa
gacgctttcggtcacaagtatatctcaggcaccgcagcttatcttgctgatcttgttagc
cgtgatctgggactacgagctcggtacgataagccgggcaccatccagaggatgtctatg
gcaatggctagccaggtggatctggaagaggcttatatggtgggacgatatgctgtagaa
gaggttaccaagggtactaccaaccgcatggtaaccatagaacggatatcaaacgacccc
tatatgagtaagcctggtctggtagagctggagaagatagccaaccagcaaaaactttta
cctgaggaatacatctcgccagagggcaatttcgttacaaaggcgtttgtggagtacgca
atgccacttattggtgggagtgccgtgagctttccgcgcctgcaaggcaagagaatagcc
ctgaagacaatctag

DBGET integrated database retrieval system