KEGG   Thermobaculum terrenum: Tter_0786Help
Entry
Tter_0786         CDS       T01134                                 

Definition
Succinate dehydrogenase hydrophobic anchor subunit-like protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ttr  Thermobaculum terrenum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tter_0786
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tter_0786
   00650 Butanoate metabolism
    Tter_0786
  Energy metabolism
   00190 Oxidative phosphorylation
    Tter_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(840609..840989)
Genome map
AA seq 126 aa AA seqDB search
MYDRRRAERPTGTFELWSWYYFRISGVLLLFLALGHVYIMHIATPVEQINYAFVAARYAT
PFWRTYDLVLLLLAMSHGVNGIRVIIHDYIRSRSWRLFALSALYSISLIFTVLGALVILT
FQPQTS
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatagacgaagggcagagaggccgacaggcaccttcgagctttggtcttggtat
tacttcaggatttcaggcgtgcttcttctgtttctggcactagggcatgtgtacatcatg
catatagccactcctgttgagcagataaactatgctttcgtggcagctagatatgcaact
ccattctggaggacttacgatctagtattgttgctattggctatgagtcatggagtcaac
ggtataagagtaataatccacgactacatcagatcccgcagctggcggttgtttgcgcta
tcagccctttactccatatctctcatattcacggttctcggagcgttggtaatactaacc
ttccaacctcagactagctaa

DBGET integrated database retrieval system